Products

cDNA Clones (21)
Proteins (15)
Antibodies (7)
Jump to Filters
View as table Download
15 Lipoxygenase 2 (ALOX15B) (NM_001141) Human Tagged ORF Clone
RC211380

USD 420.00

In Stock

ALOX15B (Myc-DDK-tagged)-Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant d

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Tagged ORF Clone
RC214018

USD 600.00

In Stock

ALOX15B (Myc-DDK-tagged)-Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
15 Lipoxygenase 2 (ALOX15B) (NM_001039131) Human Tagged ORF Clone
RC214075

USD 550.00

In Stock

ALOX15B (Myc-DDK-tagged)-Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant b

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
15 Lipoxygenase 2 (ALOX15B) (NM_001141) Human Tagged ORF Clone
RG211380

USD 460.00

In Stock

ALOX15B (GFP-tagged) - Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant d

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
15 Lipoxygenase 2 (ALOX15B) (NM_001141) Human Tagged ORF Clone Lentiviral Particle
RC211380L3V

USD 820.00

6 Weeks

Lenti ORF particles, ALOX15B (Myc-DDK tagged) - Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
15 Lipoxygenase 2 (ALOX15B) (NM_001141) Human Tagged ORF Clone Lentiviral Particle
RC211380L4V

USD 820.00

6 Weeks

Lenti ORF particles, ALOX15B (mGFP-tagged) - Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Tagged ORF Clone Lentiviral Particle
RC214018L3V

USD 1,000.00

6 Weeks

Lenti ORF particles, ALOX15B (Myc-DDK-tagged)-Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Tagged ORF Clone Lentiviral Particle
RC214018L4V

USD 1,000.00

6 Weeks

Lenti ORF particles, ALOX15B (mGFP-tagged)-Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
15 Lipoxygenase 2 (ALOX15B) (NM_001039131) Human Tagged ORF Clone Lentiviral Particle
RC214075L3V

USD 950.00

6 Weeks

Lenti ORF particles, ALOX15B (Myc-DDK-tagged)-Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
15 Lipoxygenase 2 (ALOX15B) (NM_001039131) Human Tagged ORF Clone Lentiviral Particle
RC214075L4V

USD 950.00

6 Weeks

Lenti ORF particles, ALOX15B (mGFP-tagged)-Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Tagged ORF Clone
RG214018

USD 660.00

3 Weeks

ALOX15B (GFP-tagged) - Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
15 Lipoxygenase 2 (ALOX15B) (NM_001039131) Human Tagged ORF Clone
RG214075

USD 600.00

3 Weeks

ALOX15B (GFP-tagged) - Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA346268

USD 410.00

5 Days

Rabbit Polyclonal Anti-ALOX15B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the C terminal of human ALOX15B. Synthetic peptide located within the following region: ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA346267

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALOX15B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the N terminal of human ALOX15B. Synthetic peptide located within the following region: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA346276

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALOX15B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the middle region of human ALOX15B. Synthetic peptide located within the following region: CHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVI
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA346277

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALOX15B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX15B antibody: synthetic peptide directed towards the middle region of human ALOX15B. Synthetic peptide located within the following region: LLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGFSELIQRNMKQLN
15 Lipoxygenase 2 (ALOX15B) (C-term) Rabbit Polyclonal Antibody
AP50153PU-N

USD 450.00

2 Weeks

15 Lipoxygenase 2 (ALOX15B) (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 605~634 amino acids from the C-terminal region of human ALOX15B
15 Lipoxygenase 2 (ALOX15B) (NM_001039131) Human Over-expression Lysate
LY422019

USD 605.00

4 Weeks

Transient overexpression lysate of arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant b

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
15 Lipoxygenase 2 (ALOX15B) (NM_001141) Human Untagged Clone
SC125545

USD 760.00

In Stock

ALOX15B (untagged)-Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant d

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Over-expression Lysate
LC422018

USD 187.00

In Stock

ALOX15B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
15 Lipoxygenase 2 (ALOX15B) (NM_001039131) Human Over-expression Lysate
LC422019

USD 187.00

In Stock

ALOX15B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
15 Lipoxygenase 2 (ALOX15B) (NM_001141) Human Over-expression Lysate
LY400457

USD 605.00

5 Days

Transient overexpression lysate of arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant d

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Over-expression Lysate
LY422018

USD 605.00

In Stock

Transient overexpression lysate of arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant a

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA354514

USD 325.00

5 Days

Rabbit anti 15-Lox-2 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
15 Lipoxygenase 2 (ALOX15B) (NM_001141) Human Over-expression Lysate
LC400457

USD 187.00

2 Weeks

ALOX15B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
15 Lipoxygenase 2 (ALOX15B) (NM_001039131) Human Untagged Clone
SC310837

USD 1,020.00

3 Weeks

ALOX15B (untagged)-Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant b

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
15 Lipoxygenase 2 (ALOX15B) (NM_001039130) Human Untagged Clone
SC310848

USD 1,090.00

3 Weeks

ALOX15B (untagged)-Human arachidonate 15-lipoxygenase, type B (ALOX15B), transcript variant a

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
15 Lipoxygenase 2 (ALOX15B) Rabbit Polyclonal Antibody
TA323365

USD 345.00

In Stock

Anti-ALOX15B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 30-351 amino acids of human arachidonate 15-lipoxygenase, type B
15 Lipoxygenase 2 (ALOX15B) ICC Control Block
TB411380

USD 1,070.00

4 Weeks

Transient overexpression of ALOX15B (NM_001141) in HEK293T cells paraffin embedded controls for ICC/IHC staining

15 Lipoxygenase 2 (ALOX15B) ICC Control Block
TB414018

USD 1,250.00

4 Weeks

Transient overexpression of ALOX15B (NM_001039130) in HEK293T cells paraffin embedded controls for ICC/IHC staining

15 Lipoxygenase 2 (ALOX15B) ICC Control Block
TB414075

USD 1,200.00

4 Weeks

Transient overexpression of ALOX15B (NM_001039131) in HEK293T cells paraffin embedded controls for ICC/IHC staining

15 Lipoxygenase 2 (ALOX15B) Cytosection
TS411380

USD 225.00

4 Weeks

Transient overexpression of ALOX15B (NM_001141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

15 Lipoxygenase 2 (ALOX15B) Cytosection
TS411380P5

USD 889.00

4 Weeks

Transient overexpression of ALOX15B (NM_001141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

15 Lipoxygenase 2 (ALOX15B) Cytosection
TS414018

USD 225.00

4 Weeks

Transient overexpression of ALOX15B (NM_001039130) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

15 Lipoxygenase 2 (ALOX15B) Cytosection
TS414018P5

USD 889.00

4 Weeks

Transient overexpression of ALOX15B (NM_001039130) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

15 Lipoxygenase 2 (ALOX15B) Cytosection
TS414075

USD 225.00

4 Weeks

Transient overexpression of ALOX15B (NM_001039131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

15 Lipoxygenase 2 (ALOX15B) Cytosection
TS414075P5

USD 889.00

4 Weeks

Transient overexpression of ALOX15B (NM_001039131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack