Products

View as table Download

CYP2B6 (untagged)-Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

CYP2B6 (GFP-tagged) - Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CYP2B6 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CYP2B6 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit polyclonal CYP2B6 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP2B6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the Central region of human CYP2B6.

Rabbit Polyclonal Anti-CYP2B6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL

Rabbit Polyclonal Anti-Cytochrome P450 2B6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2B6 Antibody: A synthesized peptide derived from human Cytochrome P450 2B6

Lenti ORF clone of Human cytochrome P450, family 2, subfamily B, polypeptide 6 (CYP2B6), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal Cytochrome P450 2B6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2B6.
Modifications Phospho-specific

Rabbit polyclonal Cytochrome P450 2B6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Cytochrome P450 2B6.
Modifications Phospho-specific

CYP2B6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Carrier-free (BSA/glycerol-free) CYP2B6 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

CYP2B6 MS Standard C13 and N15-labeled recombinant protein (NP_000758)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-CYP2B6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP2B6

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

CYP2B6 (Cytochrome P450 2B6) mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Transient overexpression of CYP2B6 (NM_000767) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of CYP2B6 (NM_000767) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of CYP2B6 (NM_000767) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack