Products

Proteins (11)
cDNA Clones (11)
Antibodies (7)
Jump to Filters
View as table Download
Prostaglandin D Synthase (PTGDS) (NM_000954) Human Tagged ORF Clone Lentiviral Particle
RC216795L3V

USD 820.00

5 Weeks

Lenti ORF particles, PTGDS (Myc-DDK tagged) - Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Prostaglandin D Synthase (PTGDS) (NM_000954) Human Tagged ORF Clone Lentiviral Particle
RC216795L4V

USD 820.00

7 Weeks

Lenti ORF particles, PTGDS (mGFP-tagged) - Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Prostaglandin D Synthase (PTGDS) Rabbit Polyclonal Antibody
TA346541

USD 475.00

5 Days

Rabbit Polyclonal Anti-PTGDS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGDS antibody: synthetic peptide directed towards the N terminal of human PTGDS. Synthetic peptide located within the following region: MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS
Prostaglandin D Synthase (PTGDS) Rabbit Polyclonal Antibody
TA301420

USD 424.00

2 Weeks

Rabbit Polyclonal Antibody against PTGDS

Applications WB
Reactivities Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog
Conjugation Unconjugated
Immunogen The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222]
Prostaglandin D Synthase (PTGDS) (NM_000954) Human Over-expression Lysate
LY400343

USD 396.00

In Stock

Transient overexpression lysate of prostaglandin D2 synthase 21kDa (brain) (PTGDS)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Prostaglandin D Synthase (PTGDS) Goat Polyclonal Antibody
TA326303

USD 375.00

5 Days

Goat Anti-PTGDS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVSVQPNFQQDK, from the internal region of the protein sequence according to NP_000945.3.
Prostaglandin D Synthase (PTGDS) (NM_000954) Human Recombinant Protein
TP720757

USD 330.00

3 Weeks

Purified recombinant protein of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS)

Tag C-6His
Expression Host HEK293
Prostaglandin D Synthase (PTGDS) Rabbit Polyclonal Antibody
TA301421

USD 424.00

5 Days

Rabbit Polyclonal Antibody against PTGDS

Applications WB
Reactivities Human, Feline, Bovine, Rabbit, Dog, Rat, Mouse, Primate
Conjugation Unconjugated
Immunogen The epitope recognized by this antibody maps to region within residue 120-190 of human PTGDS. [Swiss-Prot# P41222]
PTGDS (23-190, His-tag) Human Protein
AR09950PU-L

USD 845.00

2 Weeks

PTGDS (23-190, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
PTGDS (23-190, His-tag) Human Protein
AR09950PU-N

USD 330.00

2 Weeks

PTGDS (23-190, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Prostaglandin D Synthase (PTGDS) Rabbit Polyclonal Antibody
TA321241

USD 345.00

4 Weeks

Anti-PTGDS Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 64-325 amino acids of human prostaglandin D2 synthase 21kDa (brain)prostaglandin D2 synthase 21kDa (brain)
Prostaglandin D Synthase (PTGDS) Rabbit Polyclonal Antibody
TA321242

USD 345.00

4 Weeks

Anti-PTGDS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 64-325 amino acids of human prostaglandin D2 synthase 21kDa (brain)prostaglandin D2 synthase 21kDa (brain)
Prostaglandin D Synthase (PTGDS) Rabbit Polyclonal Antibody
TA321243

USD 345.00

In Stock

Anti-PTGDS Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-190 amino acids of human prostaglandin D2 synthase 21kDa (brain)
Prostaglandin D Synthase (PTGDS) ICC Control Block
TB416795

USD 1,040.00

4 Weeks

Transient overexpression of PTGDS (NM_000954) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Prostaglandin D Synthase (PTGDS) (NM_000954) Human Recombinant Protein
TP720757L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS)

Tag C-6His
Expression Host HEK293
Prostaglandin D Synthase (PTGDS) (NM_000954) Human Recombinant Protein
TP720757M

USD 760.00

3 Weeks

Purified recombinant protein of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS)

Tag C-6His
Expression Host HEK293
Prostaglandin D Synthase (PTGDS) Cytosection
TS416795

USD 225.00

4 Weeks

Transient overexpression of PTGDS (NM_000954) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Prostaglandin D Synthase (PTGDS) Cytosection
TS416795P5

USD 889.00

4 Weeks

Transient overexpression of PTGDS (NM_000954) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack