Germany
Japan
United Kingdom
China
USD 98.00
USD 390.00
In Stock
PTGDS (Myc-DDK-tagged)-Human prostaglandin D2 synthase 21kDa (brain) (PTGDS)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Ptgds (Myc-DDK-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, PTGDS (Myc-DDK tagged) - Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PTGDS (mGFP-tagged) - Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PTGDS (GFP-tagged) - Human prostaglandin D2 synthase 21kDa (brain) (PTGDS)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ptgds (GFP-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ptgds (Myc-DDK-tagged ORF) - Rat prostaglandin D2 synthase (brain) (Ptgds), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ptgds - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN514167 is the updated version of KN314167.
Ptgds (GFP-tagged) - Mouse prostaglandin D2 synthase (brain) (Ptgds), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ptgds (Myc-DDK-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ptgds (Myc-DDK-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ptgds (mGFP-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ptgds (GFP-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ptgds (Myc-DDK-tagged) - Mouse prostaglandin D2 synthase (brain) (Ptgds)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ptgds (Myc-DDK-tagged) - Mouse prostaglandin D2 synthase (brain) (Ptgds)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ptgds (Myc-DDK-tagged) - Mouse prostaglandin D2 synthase (brain) (Ptgds), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ptgds (mGFP-tagged) - Mouse prostaglandin D2 synthase (brain) (Ptgds)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ptgds (GFP-tagged) - Mouse prostaglandin D2 synthase (brain) (Ptgds), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PTGDS (Myc-DDK tagged) - Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, PTGDS (mGFP-tagged) - Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ptgds (Myc-DDK-tagged ORF) - Rat prostaglandin D2 synthase (brain) (Ptgds), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ptgds (Myc-DDK-tagged ORF) - Rat prostaglandin D2 synthase (brain) (Ptgds), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ptgds (mGFP-tagged ORF) - Rat prostaglandin D2 synthase (brain) (Ptgds), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ptgds (GFP-tagged ORF) - Rat prostaglandin D2 synthase (brain) (Ptgds), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PTGDS (untagged)-Human prostaglandin D2 synthase 21kDa (brain) (PTGDS)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PTGDS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGDS antibody: synthetic peptide directed towards the N terminal of human PTGDS. Synthetic peptide located within the following region: MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS |
Ptgds (untagged) - Mouse prostaglandin D2 synthase (brain) (Ptgds), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Antibody against PTGDS
| Applications | WB |
| Reactivities | Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222] |
USD 396.00
In Stock
Transient overexpression lysate of prostaglandin D2 synthase 21kDa (brain) (PTGDS)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PTGDS - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
USD 121.00
In Stock
PTGDS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Ptgds (untagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human prostaglandin D2 synthase 21kDa (brain) (PTGDS)
| Tag | C-6His |
| Expression Host | HEK293 |
Rabbit Polyclonal Antibody against PTGDS
| Applications | WB |
| Reactivities | Human, Feline, Bovine, Rabbit, Dog, Rat, Mouse, Primate |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to region within residue 120-190 of human PTGDS. [Swiss-Prot# P41222] |
Goat Anti-Ptgds Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YSRTQTLKDELKEK, from the internal region of the protein sequence according to NP_032989.2. |
PTGDS (23-190, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
PTGDS (23-190, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
PTGDS CRISPRa kit - CRISPR gene activation of human prostaglandin D2 synthase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ptgds CRISPRa kit - CRISPR gene activation of mouse prostaglandin D2 synthase (brain)
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
USD 440.00
5 Days
qPCR primer pairs and template standards against Homo sapiens gene PTGDS
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PTGDS
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qSTAR qPCR primer pairs against Mus musculus gene Ptgds
AAV ORF Particles, serotype AAV-2, Ptgds (Myc-DDK-tagged) - Mouse prostaglandin D2 synthase (brain) (cDNA clone MGC:47365 IMAGE:4481308), 250ul, >10^13 TU/mL
- AAV ORF®
-
PTGDS MS Standard C13 and N15-labeled recombinant protein (NP_000945)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ptgds (untagged ORF) - Rat prostaglandin D2 synthase (brain) (Ptgds), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- PTGDS