Lenti ORF particles, GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
- LentiORF®
Lenti ORF particles, GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GAMT (mGFP-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GAMT (GFP-tagged) - Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GAMT (mGFP-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GAMT (mGFP-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GAMT (Myc-DDK tagged) - Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GAMT (mGFP-tagged) - Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GAMT (GFP-tagged) - Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GAMT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GAMT antibody: synthetic peptide directed towards the N terminal of human GAMT. Synthetic peptide located within the following region: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM |
Lenti-ORF clone of GAMT (mGFP-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GAMT (untagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GAMT HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GAMT (untagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal anti-GAMT antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GAMT antibody: synthetic peptide directed towards the middle region of human GAMT. Synthetic peptide located within the following region: PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI |
GAMT (1-236, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
GAMT (1-236, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
GAMT HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GAMT HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of guanidinoacetate N-methyltransferase (GAMT), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of guanidinoacetate N-methyltransferase (GAMT), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GAMT MS Standard C13 and N15-labeled recombinant protein (NP_000147)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GAMT MS Standard C13 and N15-labeled recombinant protein (NP_620279)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GAMT (untagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression of GAMT (NM_000156) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GAMT (NM_138924) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Tag | N-His&C-His |
Expression Host | E. coli |
Purified recombinant protein of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Tag | N-His&C-His |
Expression Host | E. coli |
Purified recombinant protein of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Tag | N-His&C-His |
Expression Host | E. coli |
Purified recombinant protein of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Tag | N-His&C-His |
Expression Host | E. coli |
Transient overexpression of GAMT (NM_000156) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GAMT (NM_138924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GAMT (NM_138924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack