Products

cDNA Clones (28)
Proteins (12)
Antibodies (3)
Jump to Filters
View as table Download
CACNA2D2 (NM_001174051) Human Tagged ORF Clone
RC230662

USD 1,210.00

In Stock

CACNA2D2 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CACNA2D2 (NM_001174051) Human Tagged ORF Clone Lentiviral Particle
RC230662L1V

USD 1,610.00

3 Weeks

Lenti ORF particles, CACNA2D2 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CACNA2D2 (NM_001174051) Human Tagged ORF Clone Lentiviral Particle
RC230662L2V

USD 1,610.00

6 Weeks

Lenti ORF particles, CACNA2D2 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CACNA2D2 (NM_001005505) Human Tagged ORF Clone
RC219452

USD 1,200.00

In Stock

CACNA2D2 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA2D2 (NM_001005505) Human Tagged ORF Clone
RC219452L3

USD 1,400.00

3 Weeks

Lenti-ORF clone of CACNA2D2 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_001005505) Human Tagged ORF Clone Lentiviral Particle
RC219452L3V

USD 1,600.00

6 Weeks

Lenti ORF particles, CACNA2D2 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_001005505) Human Tagged ORF Clone
RC219452L4

USD 1,400.00

3 Weeks

Lenti-ORF clone of CACNA2D2 (mGFP-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_001005505) Human Tagged ORF Clone Lentiviral Particle
RC219452L4V

USD 1,600.00

6 Weeks

Lenti ORF particles, CACNA2D2 (mGFP-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_006030) Human Tagged ORF Clone
RC219542

USD 1,200.00

5 Weeks

CACNA2D2 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA2D2 (NM_006030) Human Tagged ORF Clone
RC219542L3

USD 1,400.00

5 Weeks

Lenti-ORF clone of CACNA2D2 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_006030) Human Tagged ORF Clone Lentiviral Particle
RC219542L3V

USD 1,600.00

8 Weeks

Lenti ORF particles, CACNA2D2 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_006030) Human Tagged ORF Clone
RC219542L4

USD 1,400.00

5 Weeks

Lenti-ORF clone of CACNA2D2 (mGFP-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_006030) Human Tagged ORF Clone Lentiviral Particle
RC219542L4V

USD 1,600.00

8 Weeks

Lenti ORF particles, CACNA2D2 (mGFP-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_001174051) Human Tagged ORF Clone
RC230662L3

USD 1,410.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_001174051) Human Tagged ORF Clone Lentiviral Particle
RC230662L3V

USD 1,610.00

5 Weeks

Lenti ORF particles, CACNA2D2 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_001174051) Human Tagged ORF Clone
RC230662L4

USD 1,410.00

In Stock

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_001174051) Human Tagged ORF Clone Lentiviral Particle
RC230662L4V

USD 1,610.00

3 Weeks

Lenti ORF particles, CACNA2D2 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D2 (NM_001291101) Human Tagged ORF Clone
RC239941

USD 1,130.00

4 Weeks

CACNA2D2 (myc-DDK-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA2D2 (NM_001005505) Human Tagged ORF Clone
RG219452

USD 1,320.00

3 Weeks

CACNA2D2 (GFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA2D2 (NM_006030) Human Tagged ORF Clone
RG219542

USD 1,320.00

7 Weeks

CACNA2D2 (GFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA2D2 (NM_001174051) Human Tagged ORF Clone
RG230662

USD 1,330.00

3 Weeks

CACNA2D2 (GFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA2D2 (NM_001174051) Human Tagged ORF Clone
RC230662L1

USD 1,410.00

In Stock

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CACNA2D2 (NM_001005505) Human Untagged Clone
SC300988

USD 2,320.00

In Stock

CACNA2D2 (untagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CACNA2D2 Rabbit Polyclonal Antibody
TA324518

USD 450.00

3 Weeks

Rabbit polyclonal CACNA2D2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2.
CACNA2D2 (NM_001174051) Human Tagged ORF Clone
RC230662L2

USD 1,410.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CACNA2D2 Rabbit Polyclonal Antibody
TA338138

USD 375.00

5 Days

Rabbit Polyclonal Anti-CACNA2D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA2D2 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNA2D2. Synthetic peptide located within the following region: NCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELV
CACNA2D2 (NM_001174051) Human Over-expression Lysate
LC433661

USD 187.00

2 Weeks

CACNA2D2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNA2D2 (NM_001174051) Human Over-expression Lysate
LY433661

USD 605.00

5 Days

Transient overexpression lysate of calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNA2D2 (NM_001291101) Human Tagged ORF Clone
RG239941

USD 1,170.00

2 Weeks

CACNA2D2 (GFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA2D2 (NM_006030) Human Untagged Clone
SC315221

USD 2,320.00

7 Weeks

CACNA2D2 (untagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 2

Vector pCMV6 series
Tag Tag Free
CACNA2D2 (NM_001174051) Human Untagged Clone
SC329300

USD 2,330.00

3 Weeks

CACNA2D2 (untagged)-Human calcium channel voltage-dependent alpha 2/delta subunit 2 (CACNA2D2) transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CACNA2D2 (NM_001291101) Human Untagged Clone
SC337835

USD 1,090.00

4 Weeks

CACNA2D2 (untagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 2 (CACNA2D2), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CACNA2D2 ICC Control Block
TB419452

USD 1,850.00

4 Weeks

Transient overexpression of CACNA2D2 (NM_001005505) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNA2D2 (NM_006030) ICC Control Block
TB419542

USD 1,850.00

4 Weeks

Transient overexpression of CACNA2D2 (NM_006030) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNA2D2 (NM_001174051) ICC Control Block
TB430662

USD 1,860.00

4 Weeks

Transient overexpression of CACNA2D2 (NM_001174051) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNA2D2 (NM_001291101) ICC Control Block
TB439941

USD 1,780.00

4 Weeks

Transient overexpression of CACNA2D2 (NM_001291101) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNA2D2 Cytosection
TS419452

USD 225.00

4 Weeks

Transient overexpression of CACNA2D2 (NM_001005505) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CACNA2D2 Cytosection
TS419452P5

USD 889.00

4 Weeks

Transient overexpression of CACNA2D2 (NM_001005505) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CACNA2D2 ICC Control Sections
TS419542P5

USD 889.00

4 Weeks

Transient overexpression of CACNA2D2 (NM_006030) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CACNA2D2 Cytosection
TS430662

USD 225.00

4 Weeks

Transient overexpression of CACNA2D2 (NM_001174051) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CACNA2D2 Cytosection
TS430662P5

USD 889.00

4 Weeks

Transient overexpression of CACNA2D2 (NM_001174051) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CACNA2D2 ICC Control Sections
TS439941P5

USD 889.00

4 Weeks

Transient overexpression of CACNA2D2 (NM_001291101) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack