Products

cDNA Clones (30)
Proteins (14)
Antibodies (3)
Jump to Filters
View as table Download
CACNG6 (NM_145814) Human Tagged ORF Clone
RC205809

USD 98.00

USD 390.00

In Stock

CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CACNG6 (NM_145815) Human Tagged ORF Clone
RC217298

USD 98.00

USD 390.00

In Stock

CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CACNG6 (NM_145814) Human Tagged ORF Clone Lentiviral Particle
RC205809L1V

USD 820.00

3 Weeks

Lenti ORF particles, CACNG6 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CACNG6 (NM_145814) Human Tagged ORF Clone Lentiviral Particle
RC205809L2V

USD 820.00

6 Weeks

Lenti ORF particles, CACNG6 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CACNG6 (NM_145815) Human Tagged ORF Clone Lentiviral Particle
RC217298L1V

USD 820.00

3 Weeks

Lenti ORF particles, CACNG6 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CACNG6 (NM_145815) Human Tagged ORF Clone Lentiviral Particle
RC217298L2V

USD 820.00

6 Weeks

Lenti ORF particles, CACNG6 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CACNG6 (NM_145814) Human Tagged ORF Clone
RG205809

USD 460.00

In Stock

CACNG6 (GFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNG6 (NM_145815) Human Tagged ORF Clone
RG217298

USD 460.00

In Stock

CACNG6 (GFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNG6 (NM_145814) Human Tagged ORF Clone
RC205809L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_145814) Human Tagged ORF Clone Lentiviral Particle
RC205809L3V

USD 820.00

6 Weeks

Lenti ORF particles, CACNG6 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_145814) Human Tagged ORF Clone
RC205809L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_145814) Human Tagged ORF Clone Lentiviral Particle
RC205809L4V

USD 820.00

6 Weeks

Lenti ORF particles, CACNG6 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_031897) Human Tagged ORF Clone
RC216398

USD 420.00

3 Weeks

CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNG6 (NM_031897) Human Tagged ORF Clone
RC216398L3

USD 620.00

3 Weeks

Lenti-ORF clone of CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_031897) Human Tagged ORF Clone Lentiviral Particle
RC216398L3V

USD 820.00

6 Weeks

Lenti ORF particles, CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_031897) Human Tagged ORF Clone
RC216398L4

USD 620.00

3 Weeks

Lenti-ORF clone of CACNG6 (mGFP-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_031897) Human Tagged ORF Clone Lentiviral Particle
RC216398L4V

USD 820.00

6 Weeks

Lenti ORF particles, CACNG6 (mGFP-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_145815) Human Tagged ORF Clone
RC217298L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_145815) Human Tagged ORF Clone Lentiviral Particle
RC217298L3V

USD 820.00

5 Weeks

Lenti ORF particles, CACNG6 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_145815) Human Tagged ORF Clone
RC217298L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_145815) Human Tagged ORF Clone Lentiviral Particle
RC217298L4V

USD 820.00

7 Weeks

Lenti ORF particles, CACNG6 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNG6 (NM_031897) Human Tagged ORF Clone
RG216398

USD 460.00

4 Weeks

CACNG6 (GFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNG6 (NM_145815) Human Tagged ORF Clone
RC217298L1

USD 768.00

In Stock

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CACNG6 (NM_145814) Human Untagged Clone
SC124006

USD 420.00

In Stock

CACNG6 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CACNG6 (NM_145814) Human Tagged ORF Clone
RC205809L1

USD 620.00

In Stock

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CACNG6 (NM_145814) Human Tagged ORF Clone
RC205809L2

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CACNG6 (NM_145815) Human Tagged ORF Clone
RC217298L2

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CACNG6 Rabbit Polyclonal Antibody
TA324466

USD 450.00

5 Days

Rabbit polyclonal CACNG6 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6.
CACNG6 (NM_145814) Human Untagged Clone
SC320489

USD 420.00

In Stock

CACNG6 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CACNG6 Rabbit Polyclonal Antibody
TA338716

USD 375.00

5 Days

Rabbit Polyclonal Anti-CACNG6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA
CACNG6 Rabbit Polyclonal Antibody
TA338734

USD 310.00

5 Days

Rabbit Polyclonal Anti-CACNG6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN
CACNG6 (NM_145814) Human Over-expression Lysate
LC407851

USD 121.00

2 Weeks

CACNG6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNG6 (NM_145815) Human Over-expression Lysate
LC407852

USD 121.00

2 Weeks

CACNG6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNG6 (NM_145814) Human Over-expression Lysate
LY407851

USD 396.00

5 Days

Transient overexpression lysate of calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNG6 (NM_145815) Human Over-expression Lysate
LY407852

USD 396.00

5 Days

Transient overexpression lysate of calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNG6 (NM_145814) Human Mass Spec Standard
PH305809

USD 2,055.00

3 Weeks

CACNG6 MS Standard C13 and N15-labeled recombinant protein (NP_665813)

Tag C-Myc/DDK
Expression Host HEK293
CACNG6 (NM_031897) Human Untagged Clone
SC305359

USD 420.00

4 Weeks

CACNG6 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3

Vector pCMV6 series
Tag Tag Free
CACNG6 (NM_145815) Human Untagged Clone
SC312487

USD 420.00

3 Weeks

CACNG6 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CACNG6 (NM_145814) ICC Control Block
TB405809

USD 1,040.00

4 Weeks

Transient overexpression of CACNG6 (NM_145814) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNG6 (NM_031897) ICC Control Block
TB416398

USD 1,070.00

4 Weeks

Transient overexpression of CACNG6 (NM_031897) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNG6 (NM_145815) ICC Control Block
TB417298

USD 1,040.00

4 Weeks

Transient overexpression of CACNG6 (NM_145815) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNG6 Cytosection
TS405809

USD 225.00

4 Weeks

Transient overexpression of CACNG6 (NM_145814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CACNG6 Cytosection
TS405809P5

USD 889.00

4 Weeks

Transient overexpression of CACNG6 (NM_145814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CACNG6 ICC Control Sections
TS416398P5

USD 889.00

4 Weeks

Transient overexpression of CACNG6 (NM_031897) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CACNG6 Cytosection
TS417298

USD 225.00

4 Weeks

Transient overexpression of CACNG6 (NM_145815) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CACNG6 Cytosection
TS417298P5

USD 889.00

4 Weeks

Transient overexpression of CACNG6 (NM_145815) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack