Products

cDNA Clones (27)
Proteins (18)
Antibodies (8)
Jump to Filters
View as table Download
Eph receptor A6 (EPHA6) (NM_001080448) Human Tagged ORF Clone
RC223510

USD 1,190.00

In Stock

EPHA6 (Myc-DDK-tagged)-Human EPH receptor A6 (EPHA6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Eph receptor A6 (EPHA6) (NM_173655) Human Tagged ORF Clone
RC216314

USD 420.00

In Stock

EPHA6 (Myc-DDK-tagged)-Human EPH receptor A6 (EPHA6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Eph receptor A6 (EPHA6) (NM_001080448) Human Tagged ORF Clone
RC600043

USD 660.00

In Stock

EPHA6 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens EPH receptor A6, transcript variant 1, Signal peptide (1-22) plus EC domain (23-549)

Vector pCMV6-XL5-DDK-His
Tag DDK-His
Mammalian Cell Selection None
  • TrueORF®
Eph receptor A6 (EPHA6) (NM_001080448) Human Tagged ORF Clone
RG223510

USD 1,310.00

In Stock

EPHA6 (GFP-tagged) - Human EPH receptor A6 (EPHA6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Eph receptor A6 (EPHA6) (NM_173655) Human Tagged ORF Clone Lentiviral Particle
RC216314L3V

USD 820.00

6 Weeks

Lenti ORF particles, EPHA6 (Myc-DDK tagged) - Human EPH receptor A6 (EPHA6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Eph receptor A6 (EPHA6) (NM_001080448) Human Tagged ORF Clone Lentiviral Particle
RC223510L3V

USD 1,590.00

5 Weeks

Lenti ORF particles, EPHA6 (Myc-DDK tagged) - Human EPH receptor A6 (EPHA6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Eph receptor A6 (EPHA6) (NM_001080448) Human Tagged ORF Clone Lentiviral Particle
RC223510L4V

USD 1,590.00

3 Weeks

Lenti ORF particles, EPHA6 (mGFP-tagged) - Human EPH receptor A6 (EPHA6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Eph receptor A6 (EPHA6) (NM_001278301) Human Tagged ORF Clone
RC237855

USD 420.00

2 Weeks

EPHA6 (myc-DDK-tagged) - Human EPH receptor A6 (EPHA6), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Eph receptor A6 (EPHA6) (NM_001278300) Human Tagged ORF Clone
RC237964

USD 420.00

2 Weeks

EPHA6 (myc-DDK-tagged) - Human EPH receptor A6 (EPHA6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Eph receptor A6 (EPHA6) (NM_173655) Human Tagged ORF Clone
RG216314

USD 460.00

3 Weeks

EPHA6 (GFP-tagged) - Human EPH receptor A6 (EPHA6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Eph receptor A6 (EPHA6) (NM_001080448) Human Over-expression Lysate
LY400431

USD 605.00

5 Days

Transient overexpression lysate of EPH receptor A6 (EPHA6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Eph receptor A6 (EPHA6) (NM_001080448) Human Untagged Clone
SC315863

USD 2,300.00

In Stock

EPHA6 (untagged)-Human EPH receptor A6 (EPHA6), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Eph receptor A6 (EPHA6) (NM_001080448) Human Recombinant Protein
TP700143

USD 748.00

In Stock

Purified recombinant protein of human EPH receptor A6 (EPHA6), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg

Tag C-DDK/His
Expression Host HEK293
Eph receptor A6 (EPHA6) (C-term) Rabbit Polyclonal Antibody
AP23642PU-N

USD 440.00

2 Weeks

Eph receptor A6 (EPHA6) (C-term) rabbit polyclonal antibody

Applications ELISA, IF, IHC
Reactivities Human, Mouse, Rat
Immunogen EPHA6 antibody was raised against synthetic peptide - KLH conjugated
Eph receptor A6 (EPHA6) (NM_001080448) Human Tagged ORF Clone
RC223510L2

USD 1,390.00

3 Weeks

Lenti ORF clone of Human EPH receptor A6 (EPHA6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Eph receptor A6 (EPHA6) Rabbit Polyclonal Antibody
TA316322

USD 345.00

4 Weeks

Rabbit polyclonal anti-EPHA6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA6.
Eph receptor A6 (EPHA6) Rabbit Polyclonal Antibody
TA338322

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPHA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA6 antibody is: synthetic peptide directed towards the N-terminal region of Human EPHA6. Synthetic peptide located within the following region: DTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTG
Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody [Clone ID: OTI5B9]
CF809373

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPHA6 mouse monoclonal antibody,clone OTI5B9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Eph receptor A6 (EPHA6) (NM_001080448) Human Over-expression Lysate
LC400431

USD 187.00

2 Weeks

EPHA6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Eph receptor A6 (EPHA6) (NM_173655) Human Over-expression Lysate
LC406538

USD 121.00

2 Weeks

EPHA6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Eph receptor A6 (EPHA6) (NM_173655) Human Over-expression Lysate
LC430409

USD 121.00

2 Weeks

EPHA6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Eph receptor A6 (EPHA6) (NM_173655) Human Over-expression Lysate
LY406538

USD 396.00

5 Days

Transient overexpression lysate of EPH receptor A6 (EPHA6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY406538 is the same product as LY430409.
Eph receptor A6 (EPHA6) (NM_173655) Human Over-expression Lysate
LY430409

USD 396.00

5 Days

Transient overexpression lysate of EPH receptor A6 (EPHA6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Eph receptor A6 (EPHA6) (NM_001278301) Human Tagged ORF Clone
RG237855

USD 460.00

2 Weeks

EPHA6 (GFP-tagged) - Human EPH receptor A6 (EPHA6), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Eph receptor A6 (EPHA6) (NM_001278300) Human Tagged ORF Clone
RG237964

USD 460.00

2 Weeks

EPHA6 (GFP-tagged) - Human EPH receptor A6 (EPHA6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Eph receptor A6 (EPHA6) (NM_173655) Human Untagged Clone
SC309198

USD 570.00

3 Weeks

EPHA6 (untagged)-Human EPH receptor A6 (EPHA6), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Eph receptor A6 (EPHA6) (NM_001080448) Human Untagged Clone
SC318510

USD 2,300.00

3 Weeks

EPHA6 (untagged)-Human EPH receptor A6 (EPHA6), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Eph receptor A6 (EPHA6) (NM_001278301) Human Untagged Clone
SC335749

USD 380.00

2 Weeks

EPHA6 (untagged) - Human EPH receptor A6 (EPHA6), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Eph receptor A6 (EPHA6) (NM_001278300) Human Untagged Clone
SC335858

USD 400.00

2 Weeks

EPHA6 (untagged) - Human EPH receptor A6 (EPHA6), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody [Clone ID: OTI5B9]
TA809373

USD 379.00

In Stock

EPHA6 mouse monoclonal antibody,clone OTI5B9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Eph receptor A6 (EPHA6) Mouse Monoclonal Antibody [Clone ID: OTI5B9]
TA809373S

USD 159.00

2 Days

EPHA6 mouse monoclonal antibody,clone OTI5B9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Eph receptor A6 (EPHA6) (NM_173655) ICC Control Block
TB416314

USD 1,070.00

4 Weeks

Transient overexpression of EPHA6 (NM_173655) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Eph receptor A6 (EPHA6) (NM_001080448) ICC Control Block
TB423510

USD 1,840.00

4 Weeks

Transient overexpression of EPHA6 (NM_001080448) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Eph receptor A6 (EPHA6) (NM_001278301) ICC Control Block
TB437855

USD 1,070.00

4 Weeks

Transient overexpression of EPHA6 (NM_001278301) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Eph receptor A6 (EPHA6) (NM_001278300) ICC Control Block
TB437964

USD 1,070.00

4 Weeks

Transient overexpression of EPHA6 (NM_001278300) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Eph receptor A6 (EPHA6) (NM_001080448) Human Recombinant Protein
TP762342

USD 205.00

2 Weeks

Purified recombinant protein of Human EPH receptor A6 (EPHA6), transcript variant 1, Glu225-Arg481, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
Eph receptor A6 (EPHA6) Cytosection
TS416314

USD 225.00

4 Weeks

Transient overexpression of EPHA6 (NM_173655) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Eph receptor A6 (EPHA6) Cytosection
TS416314P5

USD 889.00

4 Weeks

Transient overexpression of EPHA6 (NM_173655) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Eph receptor A6 (EPHA6) Cytosection
TS423510

USD 225.00

4 Weeks

Transient overexpression of EPHA6 (NM_001080448) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack