Products

cDNA Clones (25)
Proteins (12)
Antibodies (3)
Jump to Filters
View as table Download
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone
RC210966

USD 420.00

In Stock

SEMA7A (Myc-DDK-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone
RG210966

USD 460.00

In Stock

SEMA7A (GFP-tagged) - Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone Lentiviral Particle
RC210966L1V

USD 820.00

3 Weeks

Lenti ORF particles, SEMA7A (Myc-DDK tagged) - Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone Lentiviral Particle
RC210966L2V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA7A (mGFP-tagged) - Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_001146029) Human Tagged ORF Clone
RC228520

USD 600.00

In Stock

SEMA7A (Myc-DDK-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 7a (SEMA7A) (NM_001146030) Human Tagged ORF Clone
RC228931

USD 420.00

In Stock

SEMA7A (Myc-DDK-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone
RC210966L3

USD 620.00

3 Weeks

Lenti ORF clone of Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone Lentiviral Particle
RC210966L3V

USD 820.00

5 Weeks

Lenti ORF particles, SEMA7A (Myc-DDK tagged) - Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone
RC210966L4

USD 620.00

In Stock

Lenti ORF clone of Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone Lentiviral Particle
RC210966L4V

USD 820.00

3 Weeks

Lenti ORF particles, SEMA7A (mGFP-tagged) - Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_001146029) Human Tagged ORF Clone
RC228520L3

USD 800.00

3 Weeks

Lenti-ORF clone of SEMA7A (Myc-DDK-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_001146029) Human Tagged ORF Clone Lentiviral Particle
RC228520L3V

USD 1,000.00

6 Weeks

Lenti ORF particles, SEMA7A (Myc-DDK-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_001146029) Human Tagged ORF Clone
RC228520L4

USD 800.00

3 Weeks

Lenti-ORF clone of SEMA7A (mGFP-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_001146029) Human Tagged ORF Clone Lentiviral Particle
RC228520L4V

USD 1,000.00

6 Weeks

Lenti ORF particles, SEMA7A (mGFP-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_001146030) Human Tagged ORF Clone
RC228931L3

USD 620.00

3 Weeks

Lenti-ORF clone of SEMA7A (Myc-DDK-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_001146030) Human Tagged ORF Clone Lentiviral Particle
RC228931L3V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA7A (Myc-DDK-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_001146030) Human Tagged ORF Clone
RC228931L4

USD 620.00

3 Weeks

Lenti-ORF clone of SEMA7A (mGFP-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_001146030) Human Tagged ORF Clone Lentiviral Particle
RC228931L4V

USD 820.00

6 Weeks

Lenti ORF particles, SEMA7A (mGFP-tagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Semaphorin 7a (SEMA7A) (NM_001146029) Human Tagged ORF Clone
RG228520

USD 660.00

3 Weeks

SEMA7A (GFP-tagged) - Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 7a (SEMA7A) (NM_001146030) Human Tagged ORF Clone
RG228931

USD 460.00

3 Weeks

SEMA7A (GFP-tagged) - Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Semaphorin 7a (SEMA7A) (NM_003612) Human Untagged Clone
SC117884

USD 760.00

In Stock

SEMA7A (untagged)-Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone
RC210966L1

USD 768.00

In Stock

Lenti ORF clone of Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Semaphorin 7a (SEMA7A) Rabbit Polyclonal Antibody
TA351646

USD 345.00

In Stock

Rabbit Polyclonal Anti-SEMA7A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA7A
Semaphorin 7a (SEMA7A) (NM_003612) Human Over-expression Lysate
LY401196

USD 396.00

5 Days

Transient overexpression lysate of semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Semaphorin 7a (SEMA7A) (NM_003612) Human Tagged ORF Clone
RC210966L2

USD 620.00

3 Weeks

Lenti ORF clone of Human semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) (SEMA7A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Semaphorin 7a (SEMA7A) Rabbit Polyclonal Antibody
TA338228

USD 375.00

5 Days

Rabbit Polyclonal Anti-SEMA7A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA7A antibody is: synthetic peptide directed towards the C-terminal region of Human SEMA7A. Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME
Semaphorin 7a (SEMA7A) Rabbit Polyclonal Antibody
TA328118

USD 450.00

5 Days

Rabbit polyclonal anti-SEMA7A antibody (N-term)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SEMA7A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-202 amino acids from the N-terminal region of human SEMA7A.
Semaphorin 7a (SEMA7A) (NM_003612) Human Over-expression Lysate
LC401196

USD 121.00

2 Weeks

SEMA7A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Semaphorin 7a (SEMA7A) (NM_003612) Human Mass Spec Standard
PH310966

USD 2,055.00

3 Weeks

SEMA7A MS Standard C13 and N15-labeled recombinant protein (NP_003603)

Tag C-Myc/DDK
Expression Host HEK293
Semaphorin 7a (SEMA7A) (NM_001146029) Human Untagged Clone
SC327155

USD 1,100.00

3 Weeks

SEMA7A (untagged)-Human semaphorin 7A GPI membrane anchor (John Milton Hagen blood group) (SEMA7A) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Semaphorin 7a (SEMA7A) (NM_001146030) Human Untagged Clone
SC327566

USD 760.00

3 Weeks

SEMA7A (untagged)-Human semaphorin 7A GPI membrane anchor (John Milton Hagen blood group) (SEMA7A) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Semaphorin 7a (SEMA7A) (NM_003612) ICC Control Block
TB410966

USD 1,070.00

4 Weeks

Transient overexpression of SEMA7A (NM_003612) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Semaphorin 7a (SEMA7A) (NM_001146029) ICC Control Block
TB428520

USD 1,250.00

4 Weeks

Transient overexpression of SEMA7A (NM_001146029) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Semaphorin 7a (SEMA7A) (NM_001146030) ICC Control Block
TB428931

USD 1,070.00

4 Weeks

Transient overexpression of SEMA7A (NM_001146030) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Semaphorin 7a (SEMA7A) Cytosection
TS410966

USD 225.00

4 Weeks

Transient overexpression of SEMA7A (NM_003612) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Semaphorin 7a (SEMA7A) Cytosection
TS410966P5

USD 889.00

4 Weeks

Transient overexpression of SEMA7A (NM_003612) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Semaphorin 7a (SEMA7A) Cytosection
TS428520

USD 225.00

4 Weeks

Transient overexpression of SEMA7A (NM_001146029) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Semaphorin 7a (SEMA7A) Cytosection
TS428520P5

USD 889.00

4 Weeks

Transient overexpression of SEMA7A (NM_001146029) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Semaphorin 7a (SEMA7A) Cytosection
TS428931

USD 225.00

4 Weeks

Transient overexpression of SEMA7A (NM_001146030) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Semaphorin 7a (SEMA7A) Cytosection
TS428931P5

USD 889.00

4 Weeks

Transient overexpression of SEMA7A (NM_001146030) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack