Germany
Japan
United Kingdom
China
WNT5A (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 5A (WNT5A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
WNT5A (untagged)-Human wingless-type MMTV integration site family, member 5A (WNT5A)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human wingless-type MMTV integration site family, member 5A (WNT5A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, WNT5A (mGFP-tagged) - Human wingless-type MMTV integration site family, member 5A (WNT5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, WNT5A (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 5A (WNT5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
WNT5A (GFP-tagged) - Human wingless-type MMTV integration site family, member 5A (WNT5A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, WNT5A (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 5A (WNT5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5A (WNT5A), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, WNT5A (mGFP-tagged) - Human wingless-type MMTV integration site family, member 5A (WNT5A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
WNT5A (Myc-DDK tagged) - Homo sapiens wingless-type MMTV integration site family, member 5A (WNT5A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WNT5A (GFP-tagged) - Homo sapiens wingless-type MMTV integration site family, member 5A (WNT5A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5A (WNT5A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5A (WNT5A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of wingless-type MMTV integration site family, member 5A (WNT5A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
WNT5A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 5A (WNT5A), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Anti-WNT5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Mouse Monoclonal Wnt-5a Antibody (4M5E4)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
WNT5A MS Standard C13 and N15-labeled recombinant protein (NP_003383)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
WNT5A (untagged) - Homo sapiens wingless-type MMTV integration site family, member 5A (WNT5A), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of WNT5A (NM_003392) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WNT5A (NM_001256105) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WNT5A (NM_003392) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WNT5A (NM_003392) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of WNT5A (NM_001256105) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- WNT5A
Pathways
- Basal cell carcinoma