GTF2A1L (Myc-DDK-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2A1L (Myc-DDK-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2A1L (Myc-DDK-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2A1L (GFP-tagged) - Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GTF2A1L (Myc-DDK tagged) - Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GTF2A1L (mGFP-tagged) - Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GTF2A1L (Myc-DDK-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, GTF2A1L (Myc-DDK-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GTF2A1L (mGFP-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, GTF2A1L (mGFP-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GTF2A1L (GFP-tagged) - Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Rabbit Polyclonal Anti-ALF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV |
Rabbit Polyclonal Anti-ALF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV |
Rabbit Polyclonal Anti-GTF2A1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GTF2A1L Antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: GSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNS |
Rabbit Polyclonal Anti-GTF2A1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GTF2A1L Antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD |
Rabbit Polyclonal Anti-GTF2A1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2A1L antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: RVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEE |
Carrier-free (BSA/glycerol-free) GTF2A1L mouse monoclonal antibody,clone OTI1D3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2A1L mouse monoclonal antibody,clone OTI4B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GTF2A1L HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GTF2A1L (untagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GTF2A1L mouse monoclonal antibody,clone OTI1D3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GTF2A1L mouse monoclonal antibody,clone OTI1D3, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
GTF2A1L mouse monoclonal antibody,clone OTI1D3, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GTF2A1L mouse monoclonal antibody,clone OTI1D3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
GTF2A1L mouse monoclonal antibody,clone OTI4B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GTF2A1L mouse monoclonal antibody,clone OTI4B4, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
GTF2A1L mouse monoclonal antibody,clone OTI4B4, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
GTF2A1L mouse monoclonal antibody,clone OTI4B4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of GTF2A1L (NM_006872) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GTF2A1L (NM_001193487) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GTF2A1L (NM_006872) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GTF2A1L (NM_006872) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GTF2A1L (NM_001193487) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GTF2A1L (NM_001193487) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack