Germany
Japan
United Kingdom
China
GTF2A1L (Myc-DDK-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Gtf2a1l (Myc-DDK-tagged) - Mouse general transcription factor IIA, 1-like (Gtf2a1l)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2A1L (Myc-DDK-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2A1L (GFP-tagged) - Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2A1L - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405264 is the updated version of KN205264.
Gtf2a1l - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507414 is the updated version of KN307414.
Gtf2a1l (GFP-tagged) - Mouse general transcription factor II A, 1-like factor (Gtf2a1lf)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gtf2a1l (Myc-DDK-tagged) - Mouse general transcription factor IIA, 1-like (Gtf2a1l)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2a1l (Myc-DDK-tagged) - Mouse general transcription factor IIA, 1-like (Gtf2a1l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gtf2a1l (mGFP-tagged) - Mouse general transcription factor IIA, 1-like (Gtf2a1l)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2a1l (GFP-tagged) - Mouse general transcription factor IIA, 1-like (Gtf2a1l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2A1L (Myc-DDK tagged) - Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2A1L (mGFP-tagged) - Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GTF2A1L (Myc-DDK-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, GTF2A1L (Myc-DDK-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GTF2A1L (mGFP-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, GTF2A1L (mGFP-tagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GTF2A1L (GFP-tagged) - Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gtf2a1l (Myc-DDK-tagged ORF) - Rat general transcription factor IIA, 1-like (Gtf2a1l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gtf2a1l (Myc-DDK-tagged ORF) - Rat general transcription factor IIA, 1-like (Gtf2a1l), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2a1l (Myc-DDK-tagged ORF) - Rat general transcription factor IIA, 1-like (Gtf2a1l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gtf2a1l (mGFP-tagged ORF) - Rat general transcription factor IIA, 1-like (Gtf2a1l), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2a1l (GFP-tagged ORF) - Rat general transcription factor IIA, 1-like (Gtf2a1l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Recombinant protein of human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-ALF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV |
Rabbit Polyclonal Anti-ALF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV |
Rabbit Polyclonal Anti-GTF2A1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GTF2A1L Antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: GSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNS |
Rabbit Polyclonal Anti-GTF2A1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GTF2A1L Antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD |
Rabbit Polyclonal Anti-GTF2A1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2A1L antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: RVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEE |
Carrier-free (BSA/glycerol-free) GTF2A1L mouse monoclonal antibody,clone OTI4B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GTF2A1L CRISPRa kit - CRISPR gene activation of human general transcription factor IIA subunit 1 like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gtf2a1l CRISPRa kit - CRISPR gene activation of mouse general transcription factor IIA, 1-like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene GTF2A1L
GTF2A1L HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Gtf2a1l (untagged) - Mouse general transcription factor IIA, 1-like (Gtf2a1l), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Gtf2a1lf
Gtf2a1l (untagged ORF) - Rat general transcription factor IIA, 1-like (Gtf2a1l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GTF2A1L (untagged)-Human general transcription factor IIA, 1-like (GTF2A1L), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Gtf2a1lf (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Gtf2a1l (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
USD 420.00
4 Weeks
USD 420.00
4 Weeks
GTF2A1L mouse monoclonal antibody,clone OTI4B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GTF2A1L mouse monoclonal antibody,clone OTI4B4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Active filters
Target Symbol
- GTF2A1L