Products

Proteins (9)
cDNA Clones (7)
Antibodies (5)
Jump to Filters
View as table Download
TAF10 (NM_006284) Human Tagged ORF Clone
RC204138

USD 98.00

USD 390.00

In Stock

TAF10 (Myc-DDK-tagged)-Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TAF10 (NM_006284) Human Recombinant Protein
TP304138

USD 823.00

In Stock

Recombinant protein of human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)

Tag C-Myc/DDK
Expression Host HEK293T
TAF10 (NM_006284) Human Tagged ORF Clone
RC204138L3

USD 620.00

3 Weeks

Lenti ORF clone of Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF10 (NM_006284) Human Tagged ORF Clone Lentiviral Particle
RC204138L3V

USD 820.00

6 Weeks

Lenti ORF particles, TAF10 (Myc-DDK tagged) - Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF10 (NM_006284) Human Tagged ORF Clone
RC204138L4

USD 620.00

3 Weeks

Lenti ORF clone of Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF10 (NM_006284) Human Tagged ORF Clone Lentiviral Particle
RC204138L4V

USD 820.00

6 Weeks

Lenti ORF particles, TAF10 (mGFP-tagged) - Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TAF10 (NM_006284) Human Tagged ORF Clone
RG204138

USD 460.00

3 Weeks

TAF10 (GFP-tagged) - Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TAF10 (NM_006284) Human Over-expression Lysate
LC416752

USD 121.00

In Stock

TAF10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TAF10 (NM_006284) Human Over-expression Lysate
LY416752

USD 396.00

In Stock

Transient overexpression lysate of TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

TAF10 (NM_006284) Human Untagged Clone
SC116191

USD 310.00

In Stock

TAF10 (untagged)-Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TAF10 Rabbit Polyclonal Antibody
AP42025PU-N

USD 445.00

2 Weeks

TAF10 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish, African clawed frog
Immunogen The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the C terminal of human TAF10
TAF10 Rabbit Polyclonal Antibody
TA324657

USD 450.00

5 Days

Rabbit polyclonal TAF10 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TAF10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 121-150 amino acids from the Central region of human TAF10.
TAF10 Rabbit Polyclonal Antibody
TA329276

USD 375.00

5 Days

Rabbit Polyclonal anti-TAF10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the middle region of human TAF10. Synthetic peptide located within the following region: GFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRK
TAF10 Rabbit Polyclonal Antibody
TA329277

USD 375.00

5 Days

Rabbit Polyclonal anti-TAF10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the C terminal of human TAF10. Synthetic peptide located within the following region: DALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
TAF10 (84-218, His-tag) Human Protein
AR51170PU-N

USD 1,105.00

2 Weeks

TAF10 (84-218, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
TAF10 (84-218, His-tag) Human Protein
AR51170PU-S

USD 415.00

2 Weeks

TAF10 (84-218, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
TAF10 (NM_006284) Human Mass Spec Standard
PH304138

USD 2,055.00

3 Weeks

TAF10 MS Standard C13 and N15-labeled recombinant protein (NP_006275)

Tag C-Myc/DDK
Expression Host HEK293
TAF10 Rabbit Polyclonal Antibody
TA351784

USD 345.00

In Stock

Rabbit Polyclonal Anti-TAF10 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TAF10
TAF10 ICC Control Block
TB404138

USD 1,040.00

4 Weeks

Transient overexpression of TAF10 (NM_006284) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TAF10 Cytosection
TS404138

USD 225.00

4 Weeks

Transient overexpression of TAF10 (NM_006284) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TAF10 Cytosection
TS404138P5

USD 889.00

4 Weeks

Transient overexpression of TAF10 (NM_006284) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack