Germany
Japan
United Kingdom
China
TAF10 (Myc-DDK-tagged)-Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Taf10 (Myc-DDK-tagged) - Mouse TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TAF10 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404138 is the updated version of KN204138.
Taf10 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN517136 is the updated version of KN317136.
Taf10 (GFP-tagged) - Mouse TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Taf10 (Myc-DDK-tagged) - Mouse TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Taf10 (Myc-DDK-tagged) - Mouse TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Taf10 (mGFP-tagged) - Mouse TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Taf10 (GFP-tagged) - Mouse TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAF10 (Myc-DDK tagged) - Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAF10 (mGFP-tagged) - Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TAF10 (GFP-tagged) - Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Taf10 (Myc-DDK-tagged ORF) - Rat TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Taf10 (Myc-DDK-tagged ORF) - Rat TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Taf10 (Myc-DDK-tagged ORF) - Rat TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Taf10 (mGFP-tagged ORF) - Rat TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Taf10 (GFP-tagged ORF) - Rat TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TAF10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Taf10 (untagged) - Mouse TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (cDNA clone MGC:90659 IMAGE:5713860),, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TAF10 (untagged)-Human TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa (TAF10)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TAF10 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish, African clawed frog |
| Immunogen | The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the C terminal of human TAF10 |
Rabbit polyclonal TAF10 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TAF10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 121-150 amino acids from the Central region of human TAF10. |
Rabbit Polyclonal anti-TAF10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the middle region of human TAF10. Synthetic peptide located within the following region: GFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRK |
Rabbit Polyclonal anti-TAF10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF10 antibody: synthetic peptide directed towards the C terminal of human TAF10. Synthetic peptide located within the following region: DALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT |
TAF10 (84-218, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
TAF10 (84-218, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
TAF10 CRISPRa kit - CRISPR gene activation of human TATA-box binding protein associated factor 10
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene TAF10
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene TAF10
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qSTAR qPCR primer pairs against Mus musculus gene Taf10
TAF10 MS Standard C13 and N15-labeled recombinant protein (NP_006275)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Taf10 (untagged ORF) - Rat TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf10), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of TAF10 RNA polymerase II TATA box binding protein (TBP)-associated factor 30kDa (TAF10) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
TAF10 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Taf10 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Taf10 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-TAF10 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TAF10 |
TAF10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TAF10. |
Transient overexpression of TAF10 (NM_006284) in HEK293T cells paraffin embedded controls for ICC/IHC staining
TAF10 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
TAF10 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Taf10 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Taf10 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Taf10 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Taf10 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- TAF10