Germany
Japan
United Kingdom
China
YOD1 (Myc-DDK-tagged)-Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, YOD1 (Myc-DDK tagged) - Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, YOD1 (mGFP-tagged) - Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, YOD1 (Myc-DDK tagged) - Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, YOD1 (mGFP-tagged) - Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
YOD1 (Myc-DDK tagged) - Homo sapiens YOD1 deubiquitinase (YOD1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
YOD1 (GFP-tagged) - Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
YOD1 (GFP-tagged) - Homo sapiens YOD1 deubiquitinase (YOD1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit polyclonal YOD1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This YOD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-347 amino acids from the C-terminal region of human YOD1. |
Lenti ORF clone of Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-YOD1 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human YOD1. |
YOD1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-YOD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-YOD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human YOD1. Synthetic peptide located within the following region: ELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV |
YOD1 (1-348, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
YOD1 (1-348, His-tag) human recombinant protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
YOD1 (untagged)-Human YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) (YOD1)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
YOD1 (untagged) - Homo sapiens YOD1 deubiquitinase (YOD1), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of YOD1 (NM_018566) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of YOD1 (NM_001276320) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of YOD1 (NM_018566) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of YOD1 (NM_018566) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of YOD1 (NM_001276320) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- YOD1
Pathways
- Biosynthesis of unsaturated fatty acids