Germany
Japan
United Kingdom
China
PLCD1 (Myc-DDK-tagged)-Human phospholipase C, delta 1 (PLCD1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human phospholipase C, delta 1 (PLCD1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PLCD1 (GFP-tagged) - Human phospholipase C, delta 1 (PLCD1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phospholipase C, delta 1 (PLCD1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLCD1 (Myc-DDK tagged) - Human phospholipase C, delta 1 (PLCD1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phospholipase C, delta 1 (PLCD1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLCD1 (mGFP-tagged) - Human phospholipase C, delta 1 (PLCD1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLCD1 (Myc-DDK-tagged)-Human phospholipase C, delta 1 (PLCD1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PLCD1 (Myc-DDK-tagged)-Human phospholipase C, delta 1 (PLCD1), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLCD1 (Myc-DDK-tagged)-Human phospholipase C, delta 1 (PLCD1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PLCD1 (mGFP-tagged)-Human phospholipase C, delta 1 (PLCD1), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLCD1 (mGFP-tagged)-Human phospholipase C, delta 1 (PLCD1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLCD1 (GFP-tagged) - Human phospholipase C, delta 1 (PLCD1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of phospholipase C, delta 1 (PLCD1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-PLCD1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLCD1 antibody: synthetic peptide directed towards the N terminal of human PLCD1. Synthetic peptide located within the following region: HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ |
Rabbit Polyclonal Anti-PLCD1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLCD1 antibody: synthetic peptide directed towards the N terminal of human PLCD1. Synthetic peptide located within the following region: DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH |
PLCD1 (untagged)-Human phospholipase C, delta 1 (PLCD1), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PLCD1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PLCD1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 154-184 amino acids from the N-terminal region of human PLCD1 |
PLCD1 MS Standard C13 and N15-labeled recombinant protein (NP_006216)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PLCD1 (untagged)-Human phospholipase C, delta 1 (PLCD1), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of PLCD1 (NM_006225) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLCD1 (NM_001130964) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLCD1 (NM_006225) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLCD1 (NM_006225) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PLCD1 (NM_001130964) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PLCD1
Pathways
- Calcium signaling pathway