CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CACNG6 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CACNG6 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, CACNG6 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CACNG6 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CACNG6 (GFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CACNG6 (GFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNG6 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNG6 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNG6 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CACNG6 (mGFP-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNG6 (mGFP-tagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNG6 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CACNG6 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CACNG6 (GFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CACNG6 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal CACNG6 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
CACNG6 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CACNG6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA |
Rabbit Polyclonal Anti-CACNG6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN |
CACNG6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CACNG6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CACNG6 MS Standard C13 and N15-labeled recombinant protein (NP_665813)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CACNG6 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
CACNG6 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of CACNG6 (NM_145814) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CACNG6 (NM_031897) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CACNG6 (NM_145815) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CACNG6 (NM_145814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CACNG6 (NM_145814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CACNG6 (NM_031897) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CACNG6 (NM_145815) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CACNG6 (NM_145815) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack