Products

cDNA Clones (21)
Proteins (10)
Antibodies (6)
Jump to Filters
View as table Download
Claudin 10 (CLDN10) (NM_006984) Human Tagged ORF Clone
RC203090

USD 98.00

USD 390.00

In Stock

CLDN10 (Myc-DDK-tagged)-Human claudin 10 (CLDN10), transcript variant b

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Claudin 10 (CLDN10) (NM_006984) Human Tagged ORF Clone
RG203090

USD 460.00

In Stock

CLDN10 (GFP-tagged) - Human claudin 10 (CLDN10), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 10 (CLDN10) (NM_182848) Human Tagged ORF Clone
RG221281

USD 460.00

In Stock

CLDN10 (GFP-tagged) - Human claudin 10 (CLDN10), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 10 (CLDN10) (NM_001160100) Human Tagged ORF Clone
RC228137

USD 420.00

In Stock

CLDN10 (Myc-DDK-tagged)-Human claudin 10 (CLDN10), transcript variant a_v1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 10 (CLDN10) (NM_006984) Human Tagged ORF Clone
RC203090L4

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 10 (CLDN10), transcript variant b, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin 10 (CLDN10) (NM_182848) Human Tagged ORF Clone
RC221281

USD 420.00

3 Weeks

CLDN10 (Myc-DDK-tagged)-Human claudin 10 (CLDN10), transcript variant a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 10 (CLDN10) (NM_182848) Human Tagged ORF Clone
RC221281L3

USD 620.00

3 Weeks

Lenti-ORF clone of CLDN10 (Myc-DDK-tagged)-Human claudin 10 (CLDN10), transcript variant a

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin 10 (CLDN10) (NM_182848) Human Tagged ORF Clone
RC221281L4

USD 620.00

3 Weeks

Lenti-ORF clone of CLDN10 (mGFP-tagged)-Human claudin 10 (CLDN10), transcript variant a

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin 10 (CLDN10) (NM_001160100) Human Tagged ORF Clone Lentiviral Particle
RC228137L3V

USD 820.00

6 Weeks

Lenti ORF particles, CLDN10 (Myc-DDK tagged) - Human claudin 10 (CLDN10), transcript variant a_v1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin 10 (CLDN10) (NM_001160100) Human Tagged ORF Clone
RG228137

USD 460.00

3 Weeks

CLDN10 (GFP-tagged) - Human claudin 10 (CLDN10), transcript variant a_v1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 10 (CLDN10) (NM_006984) Human Untagged Clone
SC111728

USD 310.00

In Stock

CLDN10 (untagged)-Human claudin 10 (CLDN10), transcript variant b

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA347357

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 10 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 10 Antibody: A synthesized peptide derived from human Claudin 10
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA311647

USD 345.00

In Stock

Rabbit polyclonal Claudin 10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 10.
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA354159

USD 355.00

5 Days

Rabbit anti Claudin 10 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide from C-terminus of human claudin 10 protein.
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA333900

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLDN10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLDN10 Antibody: synthetic peptide directed towards the C terminal of human CLDN10. Synthetic peptide located within the following region: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLW
Claudin 10 (CLDN10) (NM_006984) Human Over-expression Lysate
LC402070

USD 121.00

2 Weeks

CLDN10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 10 (CLDN10) (NM_182848) Human Untagged Clone
SC307522

USD 420.00

4 Weeks

CLDN10 (untagged)-Human claudin 10 (CLDN10), transcript variant a

Vector pCMV6 series
Tag Tag Free
Claudin 10 (CLDN10) (NM_001160100) Human Untagged Clone
SC326772

USD 420.00

3 Weeks

CLDN10 (untagged)-Human claudin 10 (CLDN10) transcript variant a_v1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA321794

USD 345.00

In Stock

Anti-CLDN10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 215-228 amino acids of Human claudin 10
Claudin 10 (CLDN10) Rabbit Polyclonal Antibody
TA321795

USD 345.00

In Stock

Anti-CLDN10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 215-228 amino acids of Human claudin 11
Claudin 10 (CLDN10) (NM_006984) ICC Control Block
TB403090

USD 1,040.00

4 Weeks

Transient overexpression of CLDN10 (NM_006984) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 10 (CLDN10) (NM_182848) ICC Control Block
TB421281

USD 1,070.00

4 Weeks

Transient overexpression of CLDN10 (NM_182848) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 10 (CLDN10) (NM_001160100) ICC Control Block
TB428137

USD 1,070.00

4 Weeks

Transient overexpression of CLDN10 (NM_001160100) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 10 (CLDN10) Cytosection
TS403090

USD 225.00

4 Weeks

Transient overexpression of CLDN10 (NM_006984) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin 10 (CLDN10) Cytosection
TS403090P5

USD 889.00

4 Weeks

Transient overexpression of CLDN10 (NM_006984) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Claudin 10 (CLDN10) ICC Control Sections
TS421281P5

USD 889.00

4 Weeks

Transient overexpression of CLDN10 (NM_182848) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Claudin 10 (CLDN10) Cytosection
TS428137

USD 225.00

4 Weeks

Transient overexpression of CLDN10 (NM_001160100) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin 10 (CLDN10) Cytosection
TS428137P5

USD 889.00

4 Weeks

Transient overexpression of CLDN10 (NM_001160100) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack