Products

cDNA Clones (25)
Antibodies (13)
Proteins (12)
Jump to Filters
View as table Download
Claudin 7 (CLDN7) (NM_001307) Human Tagged ORF Clone
RC200530

USD 98.00

USD 390.00

In Stock

CLDN7 (Myc-DDK-tagged)-Human claudin 7 (CLDN7), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Claudin 7 (CLDN7) (NM_001185023) Human Tagged ORF Clone
RC229582

USD 420.00

In Stock

CLDN7 (Myc-DDK-tagged)-Human claudin 7 (CLDN7), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Claudin 7 (CLDN7) (NM_001307) Human Tagged ORF Clone
RG200530

USD 460.00

In Stock

CLDN7 (GFP-tagged) - Human claudin 7 (CLDN7), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 7 (CLDN7) (NM_001307) Human Tagged ORF Clone
RC200530L4

USD 620.00

In Stock

Lenti ORF clone of Human claudin 7 (CLDN7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin 7 (CLDN7) (NM_001185022) Human Tagged ORF Clone
RC229691

USD 420.00

3 Weeks

CLDN7 (Myc-DDK-tagged)-Human claudin 7 (CLDN7), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 7 (CLDN7) (NM_001185022) Human Tagged ORF Clone
RC229691L4

USD 620.00

3 Weeks

Lenti-ORF clone of CLDN7 (mGFP-tagged)-Human claudin 7 (CLDN7), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin 7 (CLDN7) (NM_001185023) Human Tagged ORF Clone
RG229582

USD 460.00

3 Weeks

CLDN7 (GFP-tagged) - Human claudin 7 (CLDN7), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 7 (CLDN7) (NM_001185022) Human Tagged ORF Clone
RG229691

USD 460.00

4 Weeks

CLDN7 (GFP-tagged) - Human claudin 7 (CLDN7), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 7 (CLDN7) (NM_001307) Human Untagged Clone
SC121707

USD 310.00

In Stock

CLDN7 (untagged)-Human claudin 7 (CLDN7), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Claudin 7 (CLDN7) (NM_001307) Human Over-expression Lysate
LY420015

USD 396.00

In Stock

Transient overexpression lysate of claudin 7 (CLDN7)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 7 (CLDN7) (C-term) Rabbit Polyclonal Antibody
AP50951PU-N

USD 450.00

2 Weeks

Claudin 7 (CLDN7) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 172-201 amino acids from the C-terminal region of human CLDN7
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
TA313677

USD 345.00

In Stock

Rabbit polyclonal Claudin 7 (Ab-210) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized non-phosphopeptide derived from human Claudin 7 around the phosphorylation site of tyrosine 210 (S-K-E-YP-V).
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
TA313679

USD 345.00

In Stock

Rabbit polyclonal anti-Claudin 7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 7.
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
TA327235

USD 275.00

3 Weeks

CLDN7 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLDN7
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
TA347642

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Claudin 7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 7 Antibody: A synthesized peptide derived from human Claudin 7
Claudin 7 (CLDN7) (NM_001307) Human Tagged ORF Clone
RC200530L2

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 7 (CLDN7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
AP21132PU-N

USD 407.00

2 Weeks

Claudin 7 (CLDN7) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Claudin 7 (CLDN7) (C-term) Rabbit Polyclonal Antibody
AP31031PU-N

USD 440.00

2 Weeks

Claudin 7 (CLDN7) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide from C-terminus of human claudin 7 protein
Claudin 7 (CLDN7) (NM_001307) Human Over-expression Lysate
LC420015

USD 121.00

In Stock

CLDN7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
TA313678

USD 345.00

4 Weeks

Rabbit polyclonal Claudin 7 (Tyr210) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Claudin 7 around the phosphorylation site of tyrosine 210 (S-K-E-YP-V).
Modifications Phospho-specific
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
TA329247

USD 375.00

5 Days

Rabbit Polyclonal anti-CLDN7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN7 antibody: synthetic peptide directed towards the C terminal of human CLDN7. Synthetic peptide located within the following region: GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
TA334061

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLDN7 Antibody: synthetic peptide directed towards the middle region of human CLDN7. Synthetic peptide located within the following region: GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
TA354312

USD 355.00

5 Days

Rabbit anti Claudin 7 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen peptide from C-terminus of human claudin 7 protein. This sequence is identical to human, rat, mouse and bovine.
Claudin 7 (CLDN7) (NM_001185023) Human Over-expression Lysate
LC432582

USD 121.00

2 Weeks

CLDN7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 7 (CLDN7) (NM_001185023) Human Over-expression Lysate
LY432582

USD 396.00

5 Days

Transient overexpression lysate of claudin 7 (CLDN7), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 7 (CLDN7) (NM_001185023) Human Untagged Clone
SC328220

USD 420.00

3 Weeks

CLDN7 (untagged)-Human claudin 7 (CLDN7) transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Claudin 7 (CLDN7) (NM_001185022) Human Untagged Clone
SC328329

USD 420.00

4 Weeks

CLDN7 (untagged)-Human claudin 7 (CLDN7) transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
TA323191

USD 345.00

In Stock

Anti-CLDN7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 199-212 amino acids of Human claudin 7
Claudin 7 (CLDN7) Rabbit Polyclonal Antibody
TA323192

USD 345.00

In Stock

Anti-CLDN7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 199-212 amino acids of Human claudin 7
Claudin 7 (CLDN7) ICC Control Block
TB400530

USD 1,040.00

4 Weeks

Transient overexpression of CLDN7 (NM_001307) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 7 (CLDN7) ICC Control Block
TB429582

USD 1,070.00

4 Weeks

Transient overexpression of CLDN7 (NM_001185023) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 7 (CLDN7) ICC Control Block
TB429691

USD 1,070.00

4 Weeks

Transient overexpression of CLDN7 (NM_001185022) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 7 (CLDN7) Cytosection
TS400530

USD 225.00

4 Weeks

Transient overexpression of CLDN7 (NM_001307) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin 7 (CLDN7) Cytosection
TS400530P5

USD 889.00

4 Weeks

Transient overexpression of CLDN7 (NM_001307) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Claudin 7 (CLDN7) Cytosection
TS429582

USD 225.00

4 Weeks

Transient overexpression of CLDN7 (NM_001185023) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin 7 (CLDN7) Cytosection
TS429582P5

USD 889.00

4 Weeks

Transient overexpression of CLDN7 (NM_001185023) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Claudin 7 (CLDN7) ICC Control Sections
TS429691P5

USD 889.00

4 Weeks

Transient overexpression of CLDN7 (NM_001185022) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack