Products

cDNA Clones (23)
Proteins (16)
Antibodies (6)
Jump to Filters
View as table Download
Contactin 1 (CNTN1) (NM_001843) Human Tagged ORF Clone
RC214706

USD 1,070.00

In Stock

CNTN1 (Myc-DDK-tagged)-Human contactin 1 (CNTN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Contactin 1 (CNTN1) (NM_175038) Human Tagged ORF Clone
RG220493

USD 1,170.00

3 Weeks

CNTN1 (GFP-tagged) - Human contactin 1 (CNTN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Contactin 1 (CNTN1) (NM_001843) Human Tagged ORF Clone
RG214706

USD 1,180.00

In Stock

CNTN1 (GFP-tagged) - Human contactin 1 (CNTN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Contactin 1 (CNTN1) (NM_001843) Human Tagged ORF Clone
RC214706L3

USD 1,270.00

3 Weeks

Lenti-ORF clone of CNTN1 (Myc-DDK-tagged)-Human contactin 1 (CNTN1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Contactin 1 (CNTN1) (NM_175038) Human Tagged ORF Clone
RC220493L3

USD 1,260.00

3 Weeks

Lenti ORF clone of Human contactin 1 (CNTN1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Contactin 1 (CNTN1) (NM_175038) Human Tagged ORF Clone
RC220493L4

USD 1,260.00

3 Weeks

Lenti ORF clone of Human contactin 1 (CNTN1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Contactin 1 (CNTN1) (NM_001256063) Human Tagged ORF Clone
RC233026

USD 480.00

3 Weeks

CNTN1 (Myc-DDK tagged) - Homo sapiens contactin 1 (CNTN1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Contactin 1 (CNTN1) (NM_001256064) Human Tagged ORF Clone
RC233027

USD 480.00

3 Weeks

CNTN1 (Myc-DDK tagged) - Homo sapiens contactin 1 (CNTN1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Contactin 1 (CNTN1) (NM_001256063) Human Tagged ORF Clone
RG233026

USD 530.00

3 Weeks

CNTN1 (GFP-tagged) - Homo sapiens contactin 1 (CNTN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Contactin 1 (CNTN1) (NM_001256064) Human Tagged ORF Clone
RG233027

USD 530.00

3 Weeks

CNTN1 (GFP-tagged) - Homo sapiens contactin 1 (CNTN1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Contactin 1 (CNTN1) (NM_001843) Human Tagged ORF Clone
RC214706L2

USD 1,270.00

3 Weeks

Lenti-ORF clone of CNTN1 (mGFP-tagged)-Human contactin 1 (CNTN1), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Contactin 1 (CNTN1) (NM_001843) Human Untagged Clone
SC310003

USD 2,060.00

In Stock

CNTN1 (untagged)-Human contactin 1 (CNTN1), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
SC310003 is the updated version of SC111612.
Contactin 1 (CNTN1) Mouse Monoclonal Antibody [Clone ID: S73-20]
TA326400

USD 410.00

5 Days

Mouse monoclonal Contactin/F3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Contactin 1 (CNTN1) Goat Polyclonal Antibody
TA326749

USD 375.00

5 Days

Goat Anti-contactin 1 (aa585-870) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-QVTSQEYSARLEN, from the internal region of the protein sequence according to NP_001834.2; NP_778203.1.
Contactin 1 (CNTN1) (Center) Rabbit Polyclonal Antibody
AP50992PU-N

USD 450.00

2 Weeks

Contactin 1 (CNTN1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 641~671 amino acids from the Central region of human CNTN1
Contactin 1 (CNTN1) Goat Polyclonal Antibody
TA326307

USD 375.00

5 Days

Goat Anti-contactin 1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-ENIRGKDKHQAR, from the internal region of the protein sequence according to NP_001834.2; NP_778203.1; NP_001242992.1.
Contactin 1 (CNTN1) Rabbit Polyclonal Antibody
TA342612

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNTN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the middle region of human CNTN1. Synthetic peptide located within the following region: QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW
Contactin 1 (CNTN1) Rabbit Polyclonal Antibody
TA342613

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNTN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNTN1 antibody: synthetic peptide directed towards the N terminal of human CNTN1. Synthetic peptide located within the following region: NGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATL
Contactin 1 (CNTN1) (NM_175038) Human Over-expression Lysate
LC406372

USD 187.00

2 Weeks

CNTN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Contactin 1 (CNTN1) (NM_175038) Human Over-expression Lysate
LC430423

USD 187.00

2 Weeks

CNTN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Contactin 1 (CNTN1) (NM_175038) Human Over-expression Lysate
LY406372

USD 605.00

5 Days

Transient overexpression lysate of contactin 1 (CNTN1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY406372 is the same product as LY430423.
Contactin 1 (CNTN1) (NM_175038) Human Over-expression Lysate
LY430423

USD 605.00

5 Days

Transient overexpression lysate of contactin 1 (CNTN1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Contactin 1 (CNTN1) (NM_175038) Human Mass Spec Standard
PH320493

USD 2,055.00

3 Weeks

CNTN1 MS Standard C13 and N15-labeled recombinant protein (NP_778203)

Tag C-Myc/DDK
Expression Host HEK293
Contactin 1 (CNTN1) (NM_175038) Human Untagged Clone
SC310010

USD 2,030.00

3 Weeks

CNTN1 (untagged)-Human contactin 1 (CNTN1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SC310010 is the updated version of SC108429.
Contactin 1 (CNTN1) ICC Control Block
TB414706

USD 1,720.00

4 Weeks

Transient overexpression of CNTN1 (NM_001843) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Contactin 1 (CNTN1) ICC Control Block
TB420493

USD 1,710.00

4 Weeks

Transient overexpression of CNTN1 (NM_175038) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Contactin 1 (CNTN1) ICC Control Block
TB433026

USD 1,130.00

4 Weeks

Transient overexpression of CNTN1 (NM_001256063) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Contactin 1 (CNTN1) ICC Control Block
TB433027

USD 1,130.00

4 Weeks

Transient overexpression of CNTN1 (NM_001256064) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Contactin 1 (CNTN1) Cytosection
TS414706

USD 225.00

4 Weeks

Transient overexpression of CNTN1 (NM_001843) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Contactin 1 (CNTN1) Cytosection
TS414706P5

USD 889.00

4 Weeks

Transient overexpression of CNTN1 (NM_001843) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Contactin 1 (CNTN1) Cytosection
TS420493

USD 225.00

4 Weeks

Transient overexpression of CNTN1 (NM_175038) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Contactin 1 (CNTN1) Cytosection
TS420493P5

USD 889.00

4 Weeks

Transient overexpression of CNTN1 (NM_175038) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Contactin 1 (CNTN1) ICC Control Sections
TS433026P5

USD 889.00

4 Weeks

Transient overexpression of CNTN1 (NM_001256063) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Contactin 1 (CNTN1) ICC Control Sections
TS433027P5

USD 889.00

4 Weeks

Transient overexpression of CNTN1 (NM_001256064) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack