Germany
Japan
United Kingdom
China
BUB3 (Myc-DDK-tagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
BUB3 (GFP-tagged) - Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of BUB3 (Myc-DDK-tagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BUB3 (Myc-DDK-tagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of BUB3 (mGFP-tagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BUB3 (mGFP-tagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
BUB3 (Myc-DDK-tagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BUB3 (Myc-DDK tagged) - Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BUB3 (mGFP-tagged) - Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
BUB3 (GFP-tagged) - Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-BUB3 Antibody - N-terminal region
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BUB3 antibody: synthetic peptide directed towards the N terminal of human BUB3. Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR |
BUB3 (untagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
BUB3 mouse monoclonal antibody, clone AT2H6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
BUB3 mouse monoclonal antibody, clone AT2H6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
BUB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
BUB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-BUB3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human BUB3. |
| Modifications | Phospho-specific |
BUB3 (1-328, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
BUB3 (1-328, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
BUB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY417795 is the same product as LY429219.
BUB3 MS Standard C13 and N15-labeled recombinant protein (NP_001007794)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
BUB3 (untagged)-Human budding uninhibited by benzimidazoles 3 homolog (yeast) (BUB3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-BUB3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BUB3 |
Transient overexpression of BUB3 (NM_004725) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of BUB3 (NM_001007793) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of BUB3 (NM_004725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BUB3 (NM_004725) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of BUB3 (NM_001007793) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BUB3 (NM_001007793) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- BUB3
Pathways
- Cell cycle