Germany
Japan
United Kingdom
China
Lenti ORF particles, CDC20 (mGFP-tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Products
View as table Download
CDC20 (Myc-DDK-tagged)-Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human cell division cycle 20 homolog (S. cerevisiae) (CDC20)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, CDC20 (Myc-DDK tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CDC20 (mGFP-tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC20 (Myc-DDK tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
CDC20 (GFP-tagged) - Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human cell division cycle 20 homolog (S. cerevisiae) (CDC20), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CDC20 (untagged)-Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CDC20 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
CDC20 (untagged)-Human cell division cycle 20 homolog (S. cerevisiae) (CDC20)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-CDC20 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDC20. |
Transient overexpression lysate of cell division cycle 20 homolog (S. cerevisiae) (CDC20)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-CDC20 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC20 antibody: synthetic peptide directed towards the N terminal of human CDC20. Synthetic peptide located within the following region: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH |
Mouse monoclonal Anti-Phospho-cdc20 (Ser50) Clone BM8.1
| Reactivities | Frog, Mammalian |
| Conjugation | Unconjugated |
CDC20 MS Standard C13 and N15-labeled recombinant protein (NP_001246)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-CDC20 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog |
Transient overexpression of CDC20 (NM_001255) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC20 (NM_001255) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC20 (NM_001255) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CDC20
Pathways
- Cell cycle