Products

cDNA Clones (33)
Proteins (20)
Antibodies (4)
Jump to Filters
View as table Download
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone
RC204215

USD 420.00

In Stock

GNAI2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Recombinant Protein
TP304215

USD 823.00

In Stock

Recombinant protein of human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2)

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone Lentiviral Particle
RC204215L1V

USD 820.00

3 Weeks

Lenti ORF particles, GNAI2 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone Lentiviral Particle
RC204215L2V

USD 820.00

6 Weeks

Lenti ORF particles, GNAI2 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) Human Tagged ORF Clone Lentiviral Particle
RC229876L1V

USD 820.00

6 Weeks

Lenti ORF particles, GNAI2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) Human Tagged ORF Clone Lentiviral Particle
RC229876L2V

USD 820.00

3 Weeks

Lenti ORF particles, GNAI2 (mGFP-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone
RG204215

USD 460.00

In Stock

GNAI2 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) Human Tagged ORF Clone
RG229876

USD 460.00

In Stock

GNAI2 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) Human Tagged ORF Clone
RC229876

USD 420.00

In Stock

GNAI2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone
RC204215L3

USD 620.00

3 Weeks

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone Lentiviral Particle
RC204215L3V

USD 820.00

5 Weeks

Lenti ORF particles, GNAI2 (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone Lentiviral Particle
RC204215L4V

USD 820.00

3 Weeks

Lenti ORF particles, GNAI2 (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) Human Tagged ORF Clone
RC229876L3

USD 620.00

3 Weeks

Lenti-ORF clone of GNAI2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) Human Tagged ORF Clone Lentiviral Particle
RC229876L3V

USD 820.00

7 Weeks

Lenti ORF particles, GNAI2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) Human Tagged ORF Clone
RC229876L4

USD 620.00

3 Weeks

Lenti-ORF clone of GNAI2 (mGFP-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) Human Tagged ORF Clone Lentiviral Particle
RC229876L4V

USD 820.00

7 Weeks

Lenti ORF particles, GNAI2 (mGFP-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001282618) Human Tagged ORF Clone
RC237082

USD 420.00

2 Weeks

GNAI2 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001282617) Human Tagged ORF Clone
RC237320

USD 420.00

2 Weeks

GNAI2 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001282619) Human Tagged ORF Clone
RC237566

USD 420.00

2 Weeks

GNAI2 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001282620) Human Tagged ORF Clone
RC237567

USD 420.00

2 Weeks

GNAI2 (myc-DDK-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Untagged Clone
SC118850

USD 310.00

In Stock

GNAI2 (untagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone
RC204215L1

USD 768.00

In Stock

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Untagged Clone
SC320935

USD 310.00

In Stock

GNAI2 (untagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Over-expression Lysate
LY400760

USD 396.00

In Stock

Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Tagged ORF Clone
RC204215L2

USD 620.00

3 Weeks

Lenti ORF clone of Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) Human Tagged ORF Clone
RC229876L1

USD 620.00

3 Weeks

Lenti-ORF clone of GNAI2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody
TA335038

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNAI2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAI2 antibody: synthetic peptide directed towards the C terminal of human GNAI2. Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA
G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody
TA318889

USD 355.00

3 Weeks

Rabbit polyclonal anti-Gai2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 229 of human Gai2
G protein alpha Inhibitor 2 (GNAI2) Rabbit Polyclonal Antibody
TA335037

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNAI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAI2 antibody: synthetic peptide directed towards the middle region of human GNAI2. Synthetic peptide located within the following region: EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL
G protein alpha Inhibitor 2 (1-355, His-tag) Human Protein
AR50544PU-N

USD 1,105.00

2 Weeks

G protein alpha Inhibitor 2 (1-355, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
G protein alpha Inhibitor 2 (1-355, His-tag) Human Protein
AR50544PU-S

USD 415.00

2 Weeks

G protein alpha Inhibitor 2 (1-355, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
G protein alpha Inhibitor 2 (GNAI2) (NM_001282618) Human Tagged ORF Clone
RG237082

USD 460.00

2 Weeks

GNAI2 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001282617) Human Tagged ORF Clone
RG237320

USD 460.00

2 Weeks

GNAI2 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001282619) Human Tagged ORF Clone
RG237566

USD 460.00

2 Weeks

GNAI2 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001282620) Human Tagged ORF Clone
RG237567

USD 460.00

2 Weeks

GNAI2 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) Human Untagged Clone
SC328514

USD 660.00

3 Weeks

GNAI2 (untagged)-Human guanine nucleotide binding protein (G protein) alpha inhibiting activity polypeptide 2 (GNAI2) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
G protein alpha Inhibitor 2 (GNAI2) (NM_001282618) Human Untagged Clone
SC334976

USD 477.00

2 Weeks

GNAI2 (untagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
G protein alpha Inhibitor 2 (GNAI2) (NM_001282617) Human Untagged Clone
SC335214

USD 310.00

2 Weeks

GNAI2 (untagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
G protein alpha Inhibitor 2 (GNAI2) (NM_001282619) Human Untagged Clone
SC335460

USD 350.00

2 Weeks

GNAI2 (untagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
G protein alpha Inhibitor 2 (GNAI2) (NM_001282620) Human Untagged Clone
SC335461

USD 350.00

2 Weeks

GNAI2 (untagged) - Human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
G protein alpha Inhibitor 2 (GNAI2) (NM_002070) ICC Control Block
TB404215

USD 1,070.00

4 Weeks

Transient overexpression of GNAI2 (NM_002070) in HEK293T cells paraffin embedded controls for ICC/IHC staining

G protein alpha Inhibitor 2 (GNAI2) (NM_001166425) ICC Control Block
TB429876

USD 1,070.00

4 Weeks

Transient overexpression of GNAI2 (NM_001166425) in HEK293T cells paraffin embedded controls for ICC/IHC staining

G protein alpha Inhibitor 2 (GNAI2) (NM_001282618) ICC Control Block
TB437082

USD 1,070.00

4 Weeks

Transient overexpression of GNAI2 (NM_001282618) in HEK293T cells paraffin embedded controls for ICC/IHC staining

G protein alpha Inhibitor 2 (GNAI2) (NM_001282617) ICC Control Block
TB437320

USD 1,070.00

4 Weeks

Transient overexpression of GNAI2 (NM_001282617) in HEK293T cells paraffin embedded controls for ICC/IHC staining

G protein alpha Inhibitor 2 (GNAI2) (NM_001282619) ICC Control Block
TB437566

USD 1,070.00

4 Weeks

Transient overexpression of GNAI2 (NM_001282619) in HEK293T cells paraffin embedded controls for ICC/IHC staining

G protein alpha Inhibitor 2 (GNAI2) (NM_001282620) ICC Control Block
TB437567

USD 1,070.00

4 Weeks

Transient overexpression of GNAI2 (NM_001282620) in HEK293T cells paraffin embedded controls for ICC/IHC staining

G protein alpha Inhibitor 2 (GNAI2) Cytosection
TS404215

USD 225.00

4 Weeks

Transient overexpression of GNAI2 (NM_002070) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack