Germany
Japan
United Kingdom
China
Lenti ORF particles, PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadLenti ORF particles, PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PER3 (GFP-tagged) - Human period homolog 3 (Drosophila) (PER3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PER3 (myc-DDK-tagged) - Human period circadian clock 3 (PER3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PER3 (Myc-DDK-tagged)-Human period homolog 3 (Drosophila) (PER3)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of period homolog 3 (Drosophila) (PER3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti-ORF clone of PER3 (mGFP-tagged)-Human period homolog 3 (Drosophila) (PER3)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PER3 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PER3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-PER3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PER3. |
Rabbit Polyclonal Anti-PER3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PER3 Antibody: synthetic peptide directed towards the N terminal of human PER3. Synthetic peptide located within the following region: GAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAAL |
PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PER3 (GFP-tagged) - Human period circadian clock 3 (PER3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PER3 (untagged)-Human period homolog 3 (Drosophila) (PER3)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PER3 (untagged) - Human period circadian clock 3 (PER3), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PER3 (untagged) - Human period circadian clock 3 (PER3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PER3 (untagged) - Human period circadian clock 3 (PER3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PER3 (untagged) - Human period circadian clock 3 (PER3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of PER3 (NM_016831) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PER3 (NM_001289864) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PER3 (NM_001289863) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PER3 (NM_001289861) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PER3 (NM_001289862) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PER3 (NM_016831) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PER3 (NM_016831) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PER3 (NM_001289864) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PER3 (NM_001289863) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PER3 (NM_001289861) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PER3 (NM_001289862) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PER3
Pathways
- Circadian rhythm - mammal