PCK1 (Myc-DDK-tagged)-Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PCK1 (Myc-DDK-tagged)-Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PCK1 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PCK1 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PCK1 (GFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PCK1 (Myc-DDK tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PCK1 (mGFP-tagged) - Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PCK1 (untagged)-Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PCK1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PCK1 |
Transient overexpression lysate of phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal PCK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Lenti ORF clone of Human phosphoenolpyruvate carboxykinase 1 (soluble) (PCK1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Goat Polyclonal Antibody against PCK1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EKEVEDIEKYLEDQ, from the internal region (near the C Terminus) of the protein sequence according to NP_002582.2. |
Rabbit Polyclonal Anti-PCK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
PCK1 (513-524) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bat, Canine, Equine, Human, Monkey, Rabbit |
Immunogen | Synthetic peptide from an internal region of human PCK1 |
PCK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Anti-PCK1 / PEPCKC (internal) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3. |
Rabbit polyclonal anti-PEPCK-C antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surroundign amino acid 507 of mouse PEPCK-C |
Rabbit Polyclonal Anti-PCK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the N terminal of human PCK1. Synthetic peptide located within the following region: PPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEE |
Rabbit Polyclonal Anti-PCK1 Antibody
Applications | WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
PCK1 / PEPCK1 (1-622, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
PCK1 / PEPCK1 (1-622, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
PCK1 MS Standard C13 and N15-labeled recombinant protein (NP_002582)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-PCK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PCK1 |
Transient overexpression of PCK1 (NM_002591) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PCK1 (NM_002591) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PCK1 (NM_002591) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack