Products

cDNA Clones (29)
Proteins (19)
Antibodies (11)
Jump to Filters
View as table Download
Kininogen 1 (KNG1) (NM_001166451) Human Tagged ORF Clone
RC229983

USD 420.00

In Stock

KNG1 (Myc-DDK-tagged)-Human kininogen 1 (KNG1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Kininogen 1 (KNG1) (NM_001102416) Human Tagged ORF Clone
RC220712

USD 600.00

In Stock

KNG1 (Myc-DDK-tagged)-Human kininogen 1 (KNG1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Kininogen 1 (KNG1) (NM_000893) Human Tagged ORF Clone
RG208879

USD 460.00

In Stock

KNG1 (GFP-tagged) - Human kininogen 1 (KNG1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kininogen 1 (KNG1) (NM_000893) Human Tagged ORF Clone
RC208879L3

USD 620.00

3 Weeks

Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Kininogen 1 (KNG1) (NM_000893) Human Tagged ORF Clone
RC208879L4

USD 620.00

3 Weeks

Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kininogen 1 (KNG1) (NM_001102416) Human Tagged ORF Clone
RC220712L4

USD 800.00

3 Weeks

Lenti-ORF clone of KNG1 (mGFP-tagged)-Human kininogen 1 (KNG1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Kininogen 1 (KNG1) (NM_001102416) Human Tagged ORF Clone
RG220712

USD 660.00

3 Weeks

KNG1 (GFP-tagged) - Human kininogen 1 (KNG1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kininogen 1 (KNG1) (NM_001166451) Human Tagged ORF Clone
RG229983

USD 460.00

3 Weeks

KNG1 (GFP-tagged) - Human kininogen 1 (KNG1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Kininogen 1 (KNG1) Rabbit Polyclonal Antibody
TA327132

USD 275.00

In Stock

Rabbit anti-KNG1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KNG1
Kininogen 1 (KNG1) Rabbit Polyclonal Antibody
TA308914

USD 415.00

In Stock

Rabbit Polyclonal antibody to Kininogen 1 (kininogen 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 416 of HMW Kininogen
Kininogen 1 (KNG1) (NM_001102416) Human Untagged Clone
SC316958

USD 1,090.00

In Stock

KNG1 (untagged)-Human kininogen 1 (KNG1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Kininogen 1 (KNG1) (N-term) Rabbit Polyclonal Antibody
AP52400PU-N

USD 450.00

2 Weeks

Kininogen 1 (KNG1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 145-174 amino acids from the N-terminal region of Human Kininogen-1
Kininogen 1 (KNG1) (NM_000893) Human Tagged ORF Clone
RC208879L2

USD 620.00

3 Weeks

Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Kininogen 1 (KNG1) (NM_001166451) Human Tagged ORF Clone
RC229983L2

USD 620.00

3 Weeks

Lenti ORF clone of Human kininogen 1 (KNG1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Kininogen 1 (KNG1) (NM_000893) Human Untagged Clone
SC119593

USD 310.00

In Stock

KNG1 (untagged)-Human kininogen 1 (KNG1), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Kininogen 1 (KNG1) (LMW Isoform) Goat Polyclonal Antibody
AP21467SU-N

USD 450.00

2 Weeks

Kininogen 1 (KNG1) (LMW Isoform) goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen Highly purified Molecular Weight Kininogen isolated from pooled plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Kininogen 1 (KNG1) Goat Polyclonal Antibody
AP33051SU-N

USD 450.00

2 Weeks

Kininogen 1 (KNG1) goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen Purified Kininogen from pooled Human plasma is used for the immunization.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Kininogen 1 (KNG1) (NM_000893) Human Over-expression Lysate
LC400319

USD 121.00

In Stock

KNG1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Kininogen 1 (KNG1) (NM_000893) Human Over-expression Lysate
LY400319

USD 396.00

5 Days

Transient overexpression lysate of kininogen 1 (KNG1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kininogen 1 (KNG1) (NM_001166451) Human Over-expression Lysate
LY432983

USD 396.00

In Stock

Transient overexpression lysate of kininogen 1 (KNG1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kininogen 1 (KNG1) (NM_000893) Human Untagged Clone
SC324548

USD 310.00

In Stock

KNG1 (untagged)-Human kininogen 1 (KNG1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Kininogen 1 (KNG1) Rabbit Polyclonal Antibody
TA314140

USD 345.00

4 Weeks

Rabbit polyclonal KNG1 (heavy chain, Cleaved-Lys380) antibody

Applications WB
Reactivities Human:Lys380
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human KNG1.
Kininogen 1 (KNG1) Rabbit Polyclonal Antibody
TA321224

USD 345.00

4 Weeks

Anti-KNG1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 280 amino acids of human kininogen 1
Kininogen 1 (KNG1) Goat Polyclonal Antibody
TA326302

USD 375.00

5 Days

Goat Anti-kininogen 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RITEATKTVGSDT, from the internal region (near N terminus) of the protein sequence according to NP_001095886.1; NP_000884.1; NP_001159923.1.
Kininogen 1 (KNG1) Goat Polyclonal Antibody
TA326721

USD 375.00

5 Days

Goat Anti-kininogen 1 (aa268-279) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PRDIPTNSPELE, from the internal region of the protein sequence according to NP_001095886.1; NP_000884.1; NP_001159923.1.
Kininogen 1 (KNG1) Rabbit Polyclonal Antibody
TA338316

USD 375.00

5 Days

Rabbit Polyclonal Anti-KNG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KNG1 antibody: synthetic peptide directed towards the middle region of human KNG1. Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
Kininogen 1 (KNG1) (NM_001166451) Human Over-expression Lysate
LC432983

USD 121.00

2 Weeks

KNG1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Kininogen 1 (KNG1) (NM_000893) Human Mass Spec Standard
PH308879

USD 2,055.00

3 Weeks

KNG1 MS Standard C13 and N15-labeled recombinant protein (NP_000884)

Tag C-Myc/DDK
Expression Host HEK293
Kininogen 1 (KNG1) (NM_001166451) Human Untagged Clone
SC328621

USD 670.00

3 Weeks

KNG1 (untagged)-Human kininogen 1 (KNG1) transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Kininogen 1 (KNG1) Rabbit Polyclonal Antibody
TA357555

USD 360.00

5 Days

KNG1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1
Kininogen 1 (KNG1) ICC Control Block
TB408879

USD 1,070.00

4 Weeks

Transient overexpression of KNG1 (NM_000893) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Kininogen 1 (KNG1) ICC Control Block
TB420712

USD 1,250.00

4 Weeks

Transient overexpression of KNG1 (NM_001102416) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Kininogen 1 (KNG1) ICC Control Block
TB429983

USD 1,070.00

4 Weeks

Transient overexpression of KNG1 (NM_001166451) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Kininogen 1 (KNG1) (NM_000893) Human Recombinant Protein
TP720432

USD 330.00

3 Weeks

Recombinant protein of human kininogen 1 (KNG1), transcript variant 2

Tag C-His
Expression Host HEK293