Products

View as table Download

Recombinant protein of human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3)

Tag C-Myc/DDK
Expression Host HEK293T

MYL3 (GFP-tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, MYL3 (Myc-DDK tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MYL3 (mGFP-tagged) - Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-MYL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3. Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG

Myosin light chain 3 (MYL3) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Recombinant human myosin (cardiac) light chain fragment.

Lenti ORF clone of Human myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

MYL3 (untagged)-Human myosin, light chain 3, alkali, ventricular, skeletal, slow (MYL3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

MYL3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit polyclonal anti-MYL3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MYL3.

Transient overexpression lysate of myosin, light chain 3, alkali; ventricular, skeletal, slow (MYL3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

MYL3 MS Standard C13 and N15-labeled recombinant protein (NP_000249)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-MYL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL3

Transient overexpression of MYL3 (NM_000258) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MYL3 (NM_000258) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of MYL3 (NM_000258) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack