Germany
Japan
United Kingdom
China
AP2B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
AP2B1 (Myc-DDK-tagged)-Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, AP2B1 (Myc-DDK tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, AP2B1 (mGFP-tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
AP2B1 (GFP-tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AP2B1 (Myc-DDK tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AP2B1 (mGFP-tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AP2B1 (Myc-DDK tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AP2B1 (mGFP-tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
AP2B1 (GFP-tagged) - Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Beta 2 Adaptin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
AP2B1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
AP2B1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
AP2B1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY420031 is the same product as LY429059.
Transient overexpression lysate of adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
AP2B1 (untagged)-Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
AP2B1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 516-546 amino acids from the Central region of human AP2B1 |
AP2B1 (untagged)-Human adaptor-related protein complex 2, beta 1 subunit (AP2B1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-AP2B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP |
Rabbit Polyclonal Anti-AP2B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the C terminal of human AP2B1. Synthetic peptide located within the following region: GAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVV |
Rabbit Polyclonal Anti-AP2B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI |
AP2B1 MS Standard C13 and N15-labeled recombinant protein (NP_001025177)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
AP2B1 MS Standard C13 and N15-labeled recombinant protein (NP_001273)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of AP2B1 (NM_001030006) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AP2B1 (NM_001282) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AP2B1 (NM_001030006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AP2B1 (NM_001030006) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of AP2B1 (NM_001282) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AP2B1 (NM_001282) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- AP2B1
Pathways
- Endocytosis