Products

cDNA Clones (25)
Proteins (14)
Antibodies (13)
Jump to Filters
View as table Download
SMAP2 (NM_001198979) Human Tagged ORF Clone
RC231224

USD 420.00

In Stock

SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SMAP2 (NM_022733) Human Tagged ORF Clone
RC205875

USD 420.00

In Stock

SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_001198978) Human Tagged ORF Clone
RC231209

USD 420.00

In Stock

SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_022733) Human Tagged ORF Clone
RG205875

USD 460.00

In Stock

SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_022733) Human Tagged ORF Clone
RC205875L3

USD 620.00

3 Weeks

Lenti ORF clone of Human small ArfGAP2 (SMAP2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_022733) Human Tagged ORF Clone Lentiviral Particle
RC205875L3V

USD 820.00

6 Weeks

Lenti ORF particles, SMAP2 (Myc-DDK tagged) - Human small ArfGAP2 (SMAP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_022733) Human Tagged ORF Clone
RC205875L4

USD 620.00

3 Weeks

Lenti ORF clone of Human small ArfGAP2 (SMAP2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_022733) Human Tagged ORF Clone Lentiviral Particle
RC205875L4V

USD 820.00

6 Weeks

Lenti ORF particles, SMAP2 (mGFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198980) Human Tagged ORF Clone
RC230811

USD 450.00

3 Weeks

SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_001198980) Human Tagged ORF Clone
RC230811L3

USD 650.00

3 Weeks

Lenti-ORF clone of SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198980) Human Tagged ORF Clone
RC230811L4

USD 650.00

3 Weeks

Lenti-ORF clone of SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198978) Human Tagged ORF Clone
RC231209L3

USD 620.00

3 Weeks

Lenti-ORF clone of SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198978) Human Tagged ORF Clone
RC231209L4

USD 620.00

3 Weeks

Lenti-ORF clone of SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198979) Human Tagged ORF Clone
RC231224L3

USD 620.00

3 Weeks

Lenti-ORF clone of SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198979) Human Tagged ORF Clone
RC231224L4

USD 620.00

3 Weeks

Lenti-ORF clone of SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198980) Human Tagged ORF Clone
RG230811

USD 500.00

4 Weeks

SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_001198978) Human Tagged ORF Clone
RG231209

USD 460.00

3 Weeks

SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_001198979) Human Tagged ORF Clone
RG231224

USD 460.00

3 Weeks

SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (Center) Rabbit Polyclonal Antibody
AP53941PU-N

USD 450.00

2 Weeks

SMAP2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 110-140 amino acids from the Central region of Human SMAP2.
SMAP2 (NM_001198979) Human Over-expression Lysate
LC434223

USD 121.00

In Stock

SMAP2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAP2 (NM_001198979) Human Over-expression Lysate
LY434223

USD 396.00

In Stock

Transient overexpression lysate of small ArfGAP2 (SMAP2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAP2 (NM_022733) Human Recombinant Protein
TP760639

USD 215.00

In Stock

Purified recombinant protein of Human small ArfGAP2 (SMAP2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
SMAP2 Rabbit Polyclonal Antibody
TA331295

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SMAP2. Synthetic peptide located within the following region: LPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSE
SMAP2 Rabbit Polyclonal Antibody
TA331296

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SMAP2. Synthetic peptide located within the following region: KVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQT
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI6E11]
CF811178

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SMAP2 mouse monoclonal antibody,clone OTI6E11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI9B6]
CF811191

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SMAP2 mouse monoclonal antibody,clone OTI9B6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 (NM_022733) Human Untagged Clone
SC100376

USD 760.00

4 Weeks

SMAP2 (untagged)-Human small ArfGAP2 (SMAP2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI6E11]
TA811178

USD 379.00

In Stock

SMAP2 mouse monoclonal antibody,clone OTI6E11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI6E11]
TA811178S

USD 159.00

2 Days

SMAP2 mouse monoclonal antibody,clone OTI6E11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI9B6]
TA811191

USD 379.00

In Stock

SMAP2 mouse monoclonal antibody,clone OTI9B6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI9B6]
TA811191S

USD 159.00

2 Days

SMAP2 mouse monoclonal antibody,clone OTI9B6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 (NM_022733) ICC Control Block
TB405875

USD 1,070.00

4 Weeks

Transient overexpression of SMAP2 (NM_022733) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SMAP2 (NM_001198980) ICC Control Block
TB430811

USD 1,100.00

4 Weeks

Transient overexpression of SMAP2 (NM_001198980) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SMAP2 (NM_001198978) ICC Control Block
TB431209

USD 1,070.00

4 Weeks

Transient overexpression of SMAP2 (NM_001198978) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SMAP2 (NM_001198979) ICC Control Block
TB431224

USD 1,070.00

4 Weeks

Transient overexpression of SMAP2 (NM_001198979) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SMAP2 Cytosection
TS405875

USD 225.00

4 Weeks

Transient overexpression of SMAP2 (NM_022733) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SMAP2 Cytosection
TS405875P5

USD 889.00

4 Weeks

Transient overexpression of SMAP2 (NM_022733) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SMAP2 ICC Control Sections
TS430811P5

USD 889.00

4 Weeks

Transient overexpression of SMAP2 (NM_001198980) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SMAP2 Cytosection
TS431209

USD 225.00

4 Weeks

Transient overexpression of SMAP2 (NM_001198978) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SMAP2 Cytosection
TS431209P5

USD 889.00

4 Weeks

Transient overexpression of SMAP2 (NM_001198978) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack