SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human small ArfGAP2 (SMAP2), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAP2 (Myc-DDK tagged) - Human small ArfGAP2 (SMAP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human small ArfGAP2 (SMAP2), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAP2 (mGFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SMAP2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 110-140 amino acids from the Central region of Human SMAP2. |
SMAP2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of small ArfGAP2 (SMAP2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Purified recombinant protein of Human small ArfGAP2 (SMAP2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Rabbit Polyclonal Anti-SMAP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SMAP2. Synthetic peptide located within the following region: LPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSE |
Rabbit Polyclonal Anti-SMAP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SMAP2. Synthetic peptide located within the following region: KVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQT |
Carrier-free (BSA/glycerol-free) SMAP2 mouse monoclonal antibody,clone OTI6E11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMAP2 mouse monoclonal antibody,clone OTI9B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMAP2 (untagged)-Human small ArfGAP2 (SMAP2), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SMAP2 mouse monoclonal antibody,clone OTI6E11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SMAP2 mouse monoclonal antibody,clone OTI6E11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SMAP2 mouse monoclonal antibody,clone OTI6E11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SMAP2 mouse monoclonal antibody,clone OTI6E11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMAP2 mouse monoclonal antibody,clone OTI9B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SMAP2 mouse monoclonal antibody,clone OTI9B6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SMAP2 mouse monoclonal antibody,clone OTI9B6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SMAP2 mouse monoclonal antibody,clone OTI9B6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of SMAP2 (NM_022733) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMAP2 (NM_001198980) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMAP2 (NM_001198978) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMAP2 (NM_001198979) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SMAP2 (NM_022733) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SMAP2 (NM_022733) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SMAP2 (NM_001198980) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SMAP2 (NM_001198978) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SMAP2 (NM_001198978) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack