Products

cDNA Clones (38)
Proteins (14)
Antibodies (13)
RNAi (12)
Gene Expression (5)
Jump to Filters
View as table Download
SMAP2 (NM_001198979) Human Tagged ORF Clone
RC231224

USD 420.00

In Stock

SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Smap2 (NM_133716) Mouse Tagged ORF Clone
MR206829

USD 350.00

In Stock

Smap2 (Myc-DDK-tagged) - Mouse stromal membrane-associated GTPase-activating protein 2 (Smap2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_022733) Human Tagged ORF Clone
RC205875

USD 420.00

In Stock

SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_001198978) Human Tagged ORF Clone
RC231209

USD 420.00

In Stock

SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_022733) Human Tagged ORF Clone
RG205875

USD 460.00

In Stock

SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 Human Gene Knockout Kit (CRISPR)
KN405875

USD 1,290.00

2 Weeks

SMAP2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN405875 is the updated version of KN205875.
Smap2 (NM_133716) Mouse Tagged ORF Clone
MR206829L3

USD 550.00

3 Weeks

Lenti ORF clone of Smap2 (Myc-DDK-tagged) - Mouse stromal membrane-associated GTPase-activating protein 2 (Smap2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smap2 (NM_133716) Mouse Tagged ORF Clone Lentiviral Particle
MR206829L3V

USD 750.00

6 Weeks

Lenti ORF particles, Smap2 (Myc-DDK-tagged) - Mouse stromal membrane-associated GTPase-activating protein 2 (Smap2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smap2 (NM_133716) Mouse Tagged ORF Clone
MR206829L4

USD 550.00

3 Weeks

Lenti ORF clone of Smap2 (mGFP-tagged) - Mouse stromal membrane-associated GTPase-activating protein 2 (Smap2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Smap2 (NM_133716) Mouse Tagged ORF Clone Lentiviral Particle
MR206829L4V

USD 750.00

6 Weeks

Lenti ORF particles, Smap2 (GFP-tagged) - Mouse stromal membrane-associated GTPase-activating protein 2 (Smap2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_022733) Human Tagged ORF Clone
RC205875L3

USD 620.00

3 Weeks

Lenti ORF clone of Human small ArfGAP2 (SMAP2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_022733) Human Tagged ORF Clone Lentiviral Particle
RC205875L3V

USD 820.00

6 Weeks

Lenti ORF particles, SMAP2 (Myc-DDK tagged) - Human small ArfGAP2 (SMAP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_022733) Human Tagged ORF Clone
RC205875L4

USD 620.00

3 Weeks

Lenti ORF clone of Human small ArfGAP2 (SMAP2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_022733) Human Tagged ORF Clone Lentiviral Particle
RC205875L4V

USD 820.00

6 Weeks

Lenti ORF particles, SMAP2 (mGFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198980) Human Tagged ORF Clone
RC230811

USD 450.00

3 Weeks

SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_001198980) Human Tagged ORF Clone
RC230811L3

USD 650.00

3 Weeks

Lenti-ORF clone of SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198980) Human Tagged ORF Clone
RC230811L4

USD 650.00

3 Weeks

Lenti-ORF clone of SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198978) Human Tagged ORF Clone
RC231209L3

USD 620.00

3 Weeks

Lenti-ORF clone of SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198978) Human Tagged ORF Clone
RC231209L4

USD 620.00

3 Weeks

Lenti-ORF clone of SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198979) Human Tagged ORF Clone
RC231224L3

USD 620.00

3 Weeks

Lenti-ORF clone of SMAP2 (Myc-DDK-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198979) Human Tagged ORF Clone
RC231224L4

USD 620.00

3 Weeks

Lenti-ORF clone of SMAP2 (mGFP-tagged)-Human small ArfGAP2 (SMAP2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (NM_001198980) Human Tagged ORF Clone
RG230811

USD 500.00

4 Weeks

SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_001198978) Human Tagged ORF Clone
RG231209

USD 460.00

3 Weeks

SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMAP2 (NM_001198979) Human Tagged ORF Clone
RG231224

USD 460.00

3 Weeks

SMAP2 (GFP-tagged) - Human small ArfGAP2 (SMAP2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Smap2 (NM_001100669) Rat Tagged ORF Clone
RR211289

USD 420.00

4 Weeks

Smap2 (Myc-DDK-tagged ORF) - Rat small ArfGAP2 (Smap2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Smap2 (NM_001100669) Rat Tagged ORF Clone
RR211289L3

USD 640.00

8 Weeks

Lenti ORF clone of Smap2 (Myc-DDK-tagged ORF) - Rat small ArfGAP2 (Smap2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Smap2 (NM_001100669) Rat Tagged ORF Clone
RR211289L4

USD 700.00

8 Weeks

Lenti ORF clone of Smap2 (mGFP-tagged ORF) - Rat small ArfGAP2 (Smap2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMAP2 (Center) Rabbit Polyclonal Antibody
AP53941PU-N

USD 450.00

2 Weeks

SMAP2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 110-140 amino acids from the Central region of Human SMAP2.
SMAP2 (NM_001198979) Human Over-expression Lysate
LC434223

USD 121.00

In Stock

SMAP2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAP2 (NM_001198979) Human Over-expression Lysate
LY434223

USD 396.00

In Stock

Transient overexpression lysate of small ArfGAP2 (SMAP2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMAP2 (NM_022733) Human Recombinant Protein
TP760639

USD 215.00

In Stock

Purified recombinant protein of Human small ArfGAP2 (SMAP2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
SMAP2 Rabbit Polyclonal Antibody
TA331295

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SMAP2. Synthetic peptide located within the following region: LPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSE
SMAP2 Rabbit Polyclonal Antibody
TA331296

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SMAP2. Synthetic peptide located within the following region: KVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQT
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI6E11]
CF811178

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SMAP2 mouse monoclonal antibody,clone OTI6E11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI9B6]
CF811191

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SMAP2 mouse monoclonal antibody,clone OTI9B6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human SMAP2 activation kit by CRISPRa
GA112113

USD 1,290.00

2 Weeks

SMAP2 CRISPRa kit - CRISPR gene activation of human small ArfGAP2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Smap2 activation kit by CRISPRa
GA208319

USD 1,290.00

2 Weeks

Smap2 CRISPRa kit - CRISPR gene activation of mouse small ArfGAP 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
SMAP2 Human qPCR Primer Pair (NM_022733)
HP214523

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene SMAP2

Smap2 (NM_133716) Mouse Untagged Clone
MC211000

USD 420.00

3 Weeks

Smap2 (untagged) - Mouse stromal membrane-associated GTPase-activating protein 2 (Smap2), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Smap2 Mouse qPCR Primer Pair (NM_133716)
MP216333

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Smap2

Smap2 (NM_001100669) Rat Untagged Clone
RN211289

USD 420.00

4 Weeks

Smap2 (untagged ORF) - Rat small ArfGAP2 (Smap2), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SMAP2 (NM_022733) Human Untagged Clone
SC100376

USD 760.00

4 Weeks

SMAP2 (untagged)-Human small ArfGAP2 (SMAP2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None