Products

View as table Download

USD 98.00

USD 390.00

In Stock

VPS25 (Myc-DDK-tagged)-Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

VPS25 (GFP-tagged) - Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, VPS25 (Myc-DDK tagged) - Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, VPS25 (mGFP-tagged) - Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Goat Polyclonal Antibody against VPS25

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QPNVDTRQKQ, from the internal region of the protein sequence according to NP_115729.1.

VPS25 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

VPS25 (untagged)-Human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-VPS25 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Vps25 antibody is: synthetic peptide directed towards the C-terminal region of Rat Vps25. Synthetic peptide located within the following region: LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

VPS25 (1-176, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

VPS25 (1-176, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

VPS25 MS Standard C13 and N15-labeled recombinant protein (NP_115729)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-VPS25 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Transient overexpression of VPS25 (NM_032353) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of VPS25 (NM_032353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of VPS25 (NM_032353) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack