ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ACAT1 (mGFP-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti-ORF clone of ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ACAT1 (mGFP-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ACAT1 (GFP-tagged) - Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit anti-ACAT1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACAT1 |
Lenti-ORF clone of ACAT1 (mGFP-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Goat Polyclonal Anti-ACAT1 (aa257-269) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACAT1 (aa257-269) Antibody: Peptide with sequence C-KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1. |
ACAT1 mouse monoclonal antibody, clone AT15E5, Purified
Applications | ELISA, WB |
Reactivities | Human |
Lenti-ORF clone of ACAT1 (Myc-DDK-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
ACAT1 (untagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ACAT1 (N-term) mouse monoclonal antibody, clone AT1.H11, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
ACAT1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide |
ACAT1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide from Human ACAT1. Epitope: Internal. |
Lenti-ORF clone of ACAT1 (mGFP-tagged)-Human acetyl-CoA acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ACAT1 (untagged)-Homo sapiens, Similar to acetyl-Coenzyme A acetyltransferase 1 (acetoacetyl Coenzyme A thiolase), clone MGC:13582 IMAGE:4278329, complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ACAT1 mouse monoclonal antibody, clone AT15E5, Purified
Applications | ELISA, WB |
Reactivities | Human |
ACAT1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide |
ACAT1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of acetyl-Coenzyme A acetyltransferase 1 (ACAT1), nuclear gene encoding mitochondrial protein
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-ACAT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH |
Rabbit Polyclonal Anti-ACAT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL |
Mouse anti-ACAT1 monoclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-ACAT1 polyclonal antibody
Applications | WB |
Reactivities | Human, Porcine, Rat, Murine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ACAT1. |
Goat Anti-ACAT1 (aa253-266) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DEEYKRVDFSKVPK, from the internal region of the protein sequence according to NP_000010.1. |
ACAT1 / MAT (34-427, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
ACAT1 / MAT (34-427, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression of ACAT1 (NM_000019) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACAT1 (NM_000019) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACAT1 (NM_000019) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack