Germany
Japan
United Kingdom
China
ECI2 (Myc-DDK-tagged)-Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ECI2 (Myc-DDK-tagged)-Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human peroxisomal D3,D2-enoyl-CoA isomerase (PECI), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ECI2 (GFP-tagged) - Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ECI2 (Myc-DDK-tagged)-Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ECI2 (Myc-DDK-tagged)-Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ECI2 (Myc-DDK-tagged)-Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ECI2 (mGFP-tagged)-Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ECI2 (mGFP-tagged)-Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ECI2 (Myc-DDK tagged) - Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ECI2 (mGFP-tagged) - Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ECI2 (Myc-DDK tagged) - Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ECI2 (mGFP-tagged) - Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ECI2 (GFP-tagged) - Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ECI2 (GFP-tagged) - Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-PECI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PECI antibody: synthetic peptide directed towards the middle region of human PECI. Synthetic peptide located within the following region: AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK |
ECI2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
ECI2 (untagged)-Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ECI2 (untagged)-Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PECI (ECI2) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human PECI |
PECI (1-364, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PECI (1-364, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ECI2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of peroxisomal D3,D2-enoyl-CoA isomerase (PECI), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of enoyl-CoA delta isomerase 2 (ECI2), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PECI MS Standard C13 and N15-labeled recombinant protein (NP_006108)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ECI2 (untagged)-Human enoyl-CoA delta isomerase 2 (ECI2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
ECI2 (untagged)-Human peroxisomal D3D2-enoyl-CoA isomerase (PECI) transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ECI2 (untagged)-Human peroxisomal D3D2-enoyl-CoA isomerase (PECI) transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PECI mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PECI mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of ECI2 (NM_206836) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- ECI2
Pathways
- Fatty acid metabolism