Germany
Japan
United Kingdom
China
PDGFD (Myc-DDK-tagged)-Human platelet derived growth factor D (PDGFD), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PDGFD (Myc-DDK-tagged)-Human platelet derived growth factor D (PDGFD), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, PDGFD (Myc-DDK tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PDGFD (mGFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PDGFD (GFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDGFD (GFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PDGFD (Myc-DDK tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, PDGFD (mGFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PDGFD (Myc-DDK tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, PDGFD (mGFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human platelet derived growth factor D (PDGFD), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
PDGFD (untagged)-Human platelet derived growth factor D (PDGFD), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PDGFD (untagged)-Human platelet derived growth factor D (PDGFD), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH |
Transient overexpression lysate of platelet derived growth factor D (PDGFD), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PDGFD HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PDGFD (250-370, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PDGFD (250-370, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
PDGFD HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of platelet derived growth factor D (PDGFD), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of PDGFD (NM_033135) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDGFD (NM_025208) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDGFD (NM_033135) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDGFD (NM_033135) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PDGFD (NM_025208) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDGFD (NM_025208) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PDGFD
Pathways
- Focal adhesion