Products

View as table Download

PDGFD (Myc-DDK-tagged)-Human platelet derived growth factor D (PDGFD), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PDGFD (Myc-DDK-tagged)-Human platelet derived growth factor D (PDGFD), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, Pdgfd (GFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

USD 68.00

USD 670.00

In Stock

Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Pdgfd (GFP-tagged) - Mouse platelet-derived growth factor D polypeptide (Pdgfd), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PDGFD (GFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PDGFD (GFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PDGFD - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN405520 is the updated version of KN205520.

Pdgfd - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513035 is the updated version of KN313035.

Pdgfd (GFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Pdgfd (mGFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pdgfd (GFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Pdgfd (mGFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pdgfd (GFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFD (Myc-DDK tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFD (mGFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFD (Myc-DDK tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFD (mGFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Pdgfd (Myc-DDK-tagged ORF) - Rat platelet-derived growth factor, D polypeptide (Pdgfd), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Pdgfd (Myc-DDK-tagged ORF) - Rat platelet-derived growth factor, D polypeptide (Pdgfd), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pdgfd (Myc-DDK-tagged ORF) - Rat platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Pdgfd (mGFP-tagged ORF) - Rat platelet-derived growth factor, D polypeptide (Pdgfd), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Pdgfd (GFP-tagged ORF) - Rat platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Purified recombinant protein of Human platelet derived growth factor D (PDGFD), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

Lenti ORF clone of Pdgfd (mGFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

PDGFD (untagged)-Human platelet derived growth factor D (PDGFD), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

PDGFD (untagged)-Human platelet derived growth factor D (PDGFD), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Pdgfd (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH

Transient overexpression lysate of platelet derived growth factor D (PDGFD), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PDGFD HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Pdgfd (untagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

PDGFD - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti

qSTAR qPCR primer pairs against Homo sapiens gene PDGFD

PDGFD (250-370, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli