PDGFD (Myc-DDK-tagged)-Human platelet derived growth factor D (PDGFD), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDGFD (Myc-DDK-tagged)-Human platelet derived growth factor D (PDGFD), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDGFD (Myc-DDK-tagged)-Human platelet derived growth factor D (PDGFD), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, Pdgfd (GFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, PDGFD (Myc-DDK tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PDGFD (mGFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Pdgfd (GFP-tagged) - Mouse platelet-derived growth factor D polypeptide (Pdgfd), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDGFD (GFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDGFD (GFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDGFD - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Pdgfd - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Pdgfd (GFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pdgfd (mGFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pdgfd (GFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (cDNA clone MGC:31518 IMAGE:4489485), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pdgfd (mGFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pdgfd (GFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PDGFD (Myc-DDK tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PDGFD (mGFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, PDGFD (Myc-DDK tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, PDGFD (mGFP-tagged) - Human platelet derived growth factor D (PDGFD), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Pdgfd (Myc-DDK-tagged ORF) - Rat platelet-derived growth factor, D polypeptide (Pdgfd), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Pdgfd (Myc-DDK-tagged ORF) - Rat platelet-derived growth factor, D polypeptide (Pdgfd), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pdgfd (Myc-DDK-tagged ORF) - Rat platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pdgfd (mGFP-tagged ORF) - Rat platelet-derived growth factor, D polypeptide (Pdgfd), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pdgfd (GFP-tagged ORF) - Rat platelet-derived growth factor, D polypeptide (Pdgfd), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human platelet derived growth factor D (PDGFD), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Lenti ORF clone of Pdgfd (mGFP-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PDGFD (untagged)-Human platelet derived growth factor D (PDGFD), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PDGFD (untagged)-Human platelet derived growth factor D (PDGFD), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human platelet derived growth factor D (PDGFD), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Pdgfd (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-PDGFD Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFD antibody: synthetic peptide directed towards the N terminal of human PDGFD. Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH |
Transient overexpression lysate of platelet derived growth factor D (PDGFD), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PDGFD HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Pdgfd (untagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Pdgfd (Myc-DDK-tagged) - Mouse platelet-derived growth factor, D polypeptide (Pdgfd)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PDGFD - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Format | Lentiviral particles |
Vector | pGFP-C-shLenti |
qSTAR qPCR primer pairs against Homo sapiens gene PDGFD
PDGFD (250-370, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |