Germany
Japan
United Kingdom
China
RAP1A (Myc-DDK-tagged)-Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, RAP1A (Myc-DDK tagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, RAP1A (mGFP-tagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
RAP1A (GFP-tagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAP1A (Myc-DDK-tagged)-Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAP1A (myc-DDK-tagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAP1A (GFP-tagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RAP1A (Myc-DDK tagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RAP1A (mGFP-tagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RAP1A (Myc-DDK tagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RAP1A (mGFP-tagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
RAP1A (untagged)-Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RAP1A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of RAP1A, member of RAS oncogene family (RAP1A), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAP1A (untagged)-Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RAP1A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 141-170 amino acids from the C-terminal region of Human RAP1A. |
Rabbit polyclonal antibody to RAP1A (RAP1A, member of RAS oncogene family)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 134 of RAP1 (Uniprot ID#P62834) |
Rabbit Polyclonal Anti-Rap1a Antibody
| Reactivities | Mouse, Human |
Rabbit Polyclonal Anti-RAP1A Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rap1a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rap1a. Synthetic peptide located within the following region: GQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKS |
RAP1A human protein, 25 µg
RAP1A (1-181, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
RAP1A (1-181, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
RAP1A MS Standard C13 and N15-labeled recombinant protein (NP_002875)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
RAP1A (GFP-tagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAP1A (untagged) - Human RAP1A, member of RAS oncogene family (RAP1A), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
Anti-RAP1A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Transient overexpression of RAP1A (NM_001010935) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAP1A (NM_002884) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAP1A (NM_001291896) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAP1A (NM_001010935) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAP1A (NM_001010935) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAP1A (NM_002884) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAP1A (NM_002884) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAP1A (NM_001291896) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAP1A (NM_001291896) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RAP1A
Pathways
- Focal adhesion