Products

cDNA Clones (22)
Proteins (14)
Antibodies (3)
Jump to Filters
View as table Download
RASGRF1 (NM_002891) Human Tagged ORF Clone
RC219147

USD 1,340.00

In Stock

RASGRF1 (Myc-DDK-tagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RASGRF1 (NM_153815) Human Tagged ORF Clone
RC215382

USD 450.00

In Stock

RASGRF1 (Myc-DDK-tagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RASGRF1 (NM_153815) Human Tagged ORF Clone
RC215382L3

USD 650.00

3 Weeks

Lenti ORF clone of Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_153815) Human Tagged ORF Clone Lentiviral Particle
RC215382L3V

USD 850.00

6 Weeks

Lenti ORF particles, RASGRF1 (Myc-DDK tagged) - Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_153815) Human Tagged ORF Clone
RC215382L4

USD 650.00

3 Weeks

Lenti ORF clone of Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_153815) Human Tagged ORF Clone Lentiviral Particle
RC215382L4V

USD 850.00

6 Weeks

Lenti ORF particles, RASGRF1 (mGFP-tagged) - Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_002891) Human Tagged ORF Clone
RC219147L3

USD 1,540.00

3 Weeks

Lenti ORF clone of Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_002891) Human Tagged ORF Clone Lentiviral Particle
RC219147L3V

USD 1,740.00

6 Weeks

Lenti ORF particles, RASGRF1 (Myc-DDK tagged) - Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_002891) Human Tagged ORF Clone
RC219147L4

USD 1,540.00

3 Weeks

Lenti ORF clone of Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_002891) Human Tagged ORF Clone Lentiviral Particle
RC219147L4V

USD 1,740.00

6 Weeks

Lenti ORF particles, RASGRF1 (mGFP-tagged) - Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_001145648) Human Tagged ORF Clone
RC227574

USD 1,320.00

6 Weeks

RASGRF1 (Myc-DDK-tagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RASGRF1 (NM_001145648) Human Tagged ORF Clone
RC227574L3

USD 1,520.00

6 Weeks

Lenti-ORF clone of RASGRF1 (Myc-DDK-tagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_001145648) Human Tagged ORF Clone Lentiviral Particle
RC227574L3V

USD 1,720.00

9 Weeks

Lenti ORF particles, RASGRF1 (Myc-DDK-tagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_001145648) Human Tagged ORF Clone
RC227574L4

USD 1,520.00

6 Weeks

Lenti-ORF clone of RASGRF1 (mGFP-tagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_001145648) Human Tagged ORF Clone Lentiviral Particle
RC227574L4V

USD 1,720.00

9 Weeks

Lenti ORF particles, RASGRF1 (mGFP-tagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RASGRF1 (NM_153815) Human Tagged ORF Clone
RG215382

USD 500.00

3 Weeks

RASGRF1 (GFP-tagged) - Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RASGRF1 (NM_002891) Human Tagged ORF Clone
RG219147

USD 1,470.00

3 Weeks

RASGRF1 (GFP-tagged) - Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RASGRF1 (NM_001145648) Human Tagged ORF Clone
RG227574

USD 1,450.00

6 Weeks

RASGRF1 (GFP-tagged) - Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RASGRF1 (BC040275) Human Untagged Clone
SC123451

USD 310.00

In Stock

RASGRF1 (untagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (cDNA clone MGC:35460 IMAGE:5192914), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RASGRF1 (NM_002891) Human Over-expression Lysate
LY419036

USD 605.00

In Stock

Transient overexpression lysate of Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RASGRF1 Rabbit Polyclonal Antibody
TA314421

USD 345.00

In Stock

Rabbit polyclonal anti-Ras-GRF1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Ras-GRF1.
RASGRF1 (NM_153815) Human Over-expression Lysate
LC406963

USD 187.00

In Stock

RASGRF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RASGRF1 (NM_002891) Human Over-expression Lysate
LC419036

USD 187.00

In Stock

RASGRF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RASGRF1 (NM_153815) Human Over-expression Lysate
LY406963

USD 605.00

In Stock

Transient overexpression lysate of Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RASGRF1 Rabbit Polyclonal Antibody
TA342189

USD 375.00

5 Days

Rabbit polyclonal Anti-RASGRF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the middle region of human RASGRF1. Synthetic peptide located within the following region: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG
RASGRF1 Rabbit Polyclonal Antibody
TA342190

USD 375.00

5 Days

Rabbit polyclonal Anti-RASGRF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the N terminal of human RASGRF1. Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG
RASGRF1 (NM_002891) Human Mass Spec Standard
PH319147

USD 2,055.00

3 Weeks

RASGRF1 MS Standard C13 and N15-labeled recombinant protein (NP_002882)

Tag C-Myc/DDK
Expression Host HEK293
RASGRF1 (NM_153815) Human Untagged Clone
SC310336

USD 830.00

3 Weeks

RASGRF1 (untagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
RASGRF1 (NM_002891) Human Untagged Clone
SC315326

USD 2,580.00

3 Weeks

RASGRF1 (untagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
RASGRF1 (NM_001145648) Human Untagged Clone
SC326642

USD 2,540.00

6 Weeks

RASGRF1 (untagged)-Human Ras protein-specific guanine nucleotide-releasing factor 1 (RASGRF1), transcript variant 3, mRNA

Vector pCMV6 series
Tag Tag Free
RASGRF1 ICC Control Block
TB415382

USD 1,100.00

4 Weeks

Transient overexpression of RASGRF1 (NM_153815) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RASGRF1 ICC Control Block
TB419147

USD 1,990.00

4 Weeks

Transient overexpression of RASGRF1 (NM_002891) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RASGRF1 ICC Control Block
TB427574

USD 1,970.00

4 Weeks

Transient overexpression of RASGRF1 (NM_001145648) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RASGRF1 Cytosection
TS415382

USD 225.00

4 Weeks

Transient overexpression of RASGRF1 (NM_153815) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RASGRF1 Cytosection
TS415382P5

USD 889.00

4 Weeks

Transient overexpression of RASGRF1 (NM_153815) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RASGRF1 Cytosection
TS419147

USD 225.00

4 Weeks

Transient overexpression of RASGRF1 (NM_002891) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RASGRF1 Cytosection
TS419147P5

USD 889.00

4 Weeks

Transient overexpression of RASGRF1 (NM_002891) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RASGRF1 ICC Control Sections
TS427574P5

USD 889.00

4 Weeks

Transient overexpression of RASGRF1 (NM_001145648) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack