Products

View as table Download

VEGFC (Myc-DDK-tagged)-Human vascular endothelial growth factor C (VEGFC)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

VEGFC (GFP-tagged) - Human vascular endothelial growth factor C (VEGFC)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, VEGFC (Myc-DDK tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, VEGFC (mGFP-tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

VEGFC (untagged)-Human vascular endothelial growth factor C (VEGFC)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, VEGFC (Myc-DDK tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, VEGFC (mGFP-tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Purified recombinant protein of Human vascular endothelial growth factor C (VEGFC).

Tag C-His
Expression Host HEK293

Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Purified recombinant protein of Human vascular endothelial growth factor C (VEGFC)

Tag C-His
Expression Host CHO

Rabbit polyclonal anti-VEGF-C antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant murine VEGF-C

VEGFC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human VEGF3

VEGFC mouse monoclonal antibody, clone 9E7, Purified

Applications IF, IHC, WB
Reactivities Human, Rat

Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

VEGFC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal Anti-VEGFC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD

VEGF-C / Flt4-L (112-227, His-tag) human protein, 0.25 mg

Tag His-tag

VEGF-C / Flt4-L (112-227, His-tag) human protein, 50 µg

Tag His-tag

Carrier-free (BSA/glycerol-free) VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-VEGFC Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C

VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

VEGFC mouse monoclonal antibody,clone 4A1, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

VEGFC mouse monoclonal antibody,clone 4A1, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USD 1,070.00

4 Weeks

Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Recombinant protein of human vascular endothelial growth factor C (VEGFC)

Tag C-His
Expression Host HEK293

Recombinant protein of human vascular endothelial growth factor C (VEGFC)

Tag C-His
Expression Host HEK293

Recombinant protein of human vascular endothelial growth factor C (VEGFC)

Tag C-His
Expression Host HEK293

Recombinant protein of human vascular endothelial growth factor C (VEGFC)

Tag C-His
Expression Host HEK293

USD 225.00

4 Weeks

Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack