Germany
Japan
United Kingdom
China
VEGFC (Myc-DDK-tagged)-Human vascular endothelial growth factor C (VEGFC)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
VEGFC (GFP-tagged) - Human vascular endothelial growth factor C (VEGFC)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, VEGFC (Myc-DDK tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, VEGFC (mGFP-tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
VEGFC (untagged)-Human vascular endothelial growth factor C (VEGFC)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VEGFC (Myc-DDK tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, VEGFC (mGFP-tagged) - Human vascular endothelial growth factor C (VEGFC), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human vascular endothelial growth factor C (VEGFC).
| Tag | C-His |
| Expression Host | HEK293 |
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human vascular endothelial growth factor C (VEGFC)
| Tag | C-His |
| Expression Host | CHO |
Rabbit polyclonal anti-VEGF-C antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant murine VEGF-C |
Lenti ORF clone of Human vascular endothelial growth factor C (VEGFC), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
VEGFC HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-VEGFC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD |
VEGF-C / Flt4-L (112-227, His-tag) human protein, 0.25 mg
| Tag | His-tag |
VEGF-C / Flt4-L (112-227, His-tag) human protein, 50 µg
| Tag | His-tag |
Transient overexpression lysate of vascular endothelial growth factor C (VEGFC)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Anti-VEGFC Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C |
Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human vascular endothelial growth factor C (VEGFC)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human vascular endothelial growth factor C (VEGFC)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human vascular endothelial growth factor C (VEGFC)
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human vascular endothelial growth factor C (VEGFC)
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of VEGFC (NM_005429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- VEGFC
Pathways
- Focal adhesion