Products

View as table Download

Recombinant protein of human alkaline phosphatase, placental (Regan isozyme) (ALPP)

Tag C-Myc/DDK
Expression Host HEK293T

Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)

Tag C-His
Expression Host HEK293

ALPP (GFP-tagged) - Human alkaline phosphatase, placental (ALPP)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ALPP (untagged)-Human alkaline phosphatase, placental (ALPP)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF particles, ALPP (Myc-DDK tagged) - Human alkaline phosphatase, placental (ALPP), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-ALPP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALPP antibody: synthetic peptide directed towards the C terminal of human ALPP. Synthetic peptide located within the following region: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA

Alkaline phosphatase / PLAP / ALPP human protein, 0.1 kU

Protein Source Placenta

Rabbit polyclonal antibody to Alkaline phosphatase(placental ) (alkaline phosphatase, placental (Regan isozyme))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 163 and 387 of Placental Alkaline Phosphatase (Uniprot ID#P05187)

Lenti ORF clone of Human alkaline phosphatase, placental (ALPP), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ALPP HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Alkaline Phosphatase (ALPP) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 55-83 amino acids from the N-terminal region of human ALPP

Rabbit anti PLAP Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications WB
Reactivities Human
Conjugation Unconjugated

ALPP MS Standard C13 and N15-labeled recombinant protein (NP_001623)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-ALPP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ALPP

Transient overexpression of ALPP (NM_001632) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)

Tag C-His
Expression Host HEK293

Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)

Tag C-His
Expression Host HEK293

Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)

Tag C-His
Expression Host HEK293

Transient overexpression of ALPP (NM_001632) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of ALPP (NM_001632) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack