Recombinant protein of human alkaline phosphatase, placental (Regan isozyme) (ALPP)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Recombinant protein of human alkaline phosphatase, placental (Regan isozyme) (ALPP)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
ALPP (Myc-DDK-tagged)-Human alkaline phosphatase, placental (ALPP)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)
Tag | C-His |
Expression Host | HEK293 |
USD 820.00
In Stock
Lenti ORF particles, ALPP (Myc-DDK tagged) - Human alkaline phosphatase, placental (ALPP), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, ALPP (mGFP-tagged) - Human alkaline phosphatase, placental (ALPP), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ALPP (GFP-tagged) - Human alkaline phosphatase, placental (ALPP)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human alkaline phosphatase, placental (ALPP), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, ALPP (mGFP-tagged) - Human alkaline phosphatase, placental (ALPP), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ALPP (untagged)-Human alkaline phosphatase, placental (ALPP)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 1,020.00
2 Weeks
Lenti ORF particles, ALPP (Myc-DDK tagged) - Human alkaline phosphatase, placental (ALPP), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-ALPP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALPP antibody: synthetic peptide directed towards the C terminal of human ALPP. Synthetic peptide located within the following region: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA |
Lenti ORF clone of Human alkaline phosphatase, placental (ALPP), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human alkaline phosphatase, placental (ALPP), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Alkaline phosphatase / PLAP / ALPP human protein, 0.1 kU
Protein Source | Placenta |
Rabbit polyclonal antibody to Alkaline phosphatase(placental ) (alkaline phosphatase, placental (Regan isozyme))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 163 and 387 of Placental Alkaline Phosphatase (Uniprot ID#P05187) |
Lenti ORF clone of Human alkaline phosphatase, placental (ALPP), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ALPP HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of alkaline phosphatase, placental (Regan isozyme) (ALPP)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 450.00
5 Days
Mouse monoclonal ALPP Antibody (N-term)(Ascites)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Alkaline Phosphatase/ALPP Antibody (8B6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Alkaline Phosphatase (ALPP) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 55-83 amino acids from the N-terminal region of human ALPP |
Rabbit anti PLAP Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse anti Alkaline Phosphatase (AP) Monoclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ALPP MS Standard C13 and N15-labeled recombinant protein (NP_001623)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-ALPP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ALPP |
USD 379.00
In Stock
ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of ALPP (NM_001632) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)
Tag | C-His |
Expression Host | HEK293 |
Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)
Tag | C-His |
Expression Host | HEK293 |
Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)
Tag | C-His |
Expression Host | HEK293 |
Transient overexpression of ALPP (NM_001632) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ALPP (NM_001632) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack