Germany
Japan
United Kingdom
China
Recombinant protein of human alkaline phosphatase, placental (Regan isozyme) (ALPP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Products
View as table Download
ALPP (Myc-DDK-tagged)-Human alkaline phosphatase, placental (ALPP)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)
| Tag | C-His |
| Expression Host | HEK293 |
USD 820.00
In Stock
Lenti ORF particles, ALPP (Myc-DDK tagged) - Human alkaline phosphatase, placental (ALPP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, ALPP (mGFP-tagged) - Human alkaline phosphatase, placental (ALPP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ALPP (GFP-tagged) - Human alkaline phosphatase, placental (ALPP)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human alkaline phosphatase, placental (ALPP), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, ALPP (mGFP-tagged) - Human alkaline phosphatase, placental (ALPP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ALPP (untagged)-Human alkaline phosphatase, placental (ALPP)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 1,020.00
2 Weeks
Lenti ORF particles, ALPP (Myc-DDK tagged) - Human alkaline phosphatase, placental (ALPP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-ALPP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALPP antibody: synthetic peptide directed towards the C terminal of human ALPP. Synthetic peptide located within the following region: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA |
Lenti ORF clone of Human alkaline phosphatase, placental (ALPP), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human alkaline phosphatase, placental (ALPP), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Alkaline phosphatase / PLAP / ALPP human protein, 0.1 kU
| Protein Source | Placenta |
Rabbit polyclonal antibody to Alkaline phosphatase(placental ) (alkaline phosphatase, placental (Regan isozyme))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 163 and 387 of Placental Alkaline Phosphatase (Uniprot ID#P05187) |
Lenti ORF clone of Human alkaline phosphatase, placental (ALPP), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ALPP HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of alkaline phosphatase, placental (Regan isozyme) (ALPP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
USD 450.00
5 Days
qPCR primer pairs and template standards against Homo sapiens gene ALPP
| Application | Plasmid of exact quantity for transcript copy number calculation |
Rabbit anti PLAP Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti Alkaline Phosphatase (AP) Monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ALPP CRISPRa kit - CRISPR gene activation of human alkaline phosphatase, placental
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ALPP
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
ALPP MS Standard C13 and N15-labeled recombinant protein (NP_001623)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
3`UTR clone of alkaline phosphatase placental (Regan isozyme) (ALPP) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ALPP (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Placental Alkaline Phosphatase Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Placental alkaline phosphatase (PLAP) Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-460 of human Placental alkaline phosphatase (PLAP) (NP_001623.3). |
| Modifications | Unmodified |
Placental Alkaline Phosphatase Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Placental alkaline phosphatase (PLAP) |
USD 380.00
4 Weeks
USD 379.00
In Stock
ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
ALPP mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of ALPP (NM_001632) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ALPP - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
USD 1,395.00
5 Weeks
ALPP - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human alkaline phosphatase, placental (ALPP)
| Tag | C-His |
| Expression Host | HEK293 |
ALPP - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Transient overexpression of ALPP (NM_001632) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ALPP (NM_001632) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ALPP