Products

View as table Download

GMPPB (Myc-DDK-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GMPPB (Myc-DDK-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T

GMPPB (GFP-tagged) - Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of GMPPB (Myc-DDK-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPPB (Myc-DDK-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GMPPB (mGFP-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPPB (mGFP-tagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPPB (Myc-DDK tagged) - Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GMPPB (mGFP-tagged) - Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GMPPB (GFP-tagged) - Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-GMPPB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GMPPB antibody: synthetic peptide directed towards the C terminal of human GMPPB. Synthetic peptide located within the following region: RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM

GMPPB (untagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

GMPPB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GMPPB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GMPPB MS Standard C13 and N15-labeled recombinant protein (NP_068806)

Tag C-Myc/DDK
Expression Host HEK293

GMPPB (untagged)-Human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of GMPPB (NM_021971) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of GMPPB (NM_013334) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of GMPPB (NM_021971) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GMPPB (NM_021971) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of GMPPB (NM_013334) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GMPPB (NM_013334) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack