Germany
Japan
United Kingdom
China
HTR2C (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, HTR2C (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, HTR2C (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
HTR2C (GFP-tagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HTR2C (Myc-DDK tagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HTR2C (Myc-DDK tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HTR2C (mGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HTR2C (Myc-DDK tagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HTR2C (GFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HTR2C (GFP-tagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
HTR2C (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
HTR2C rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 400-450 of Human SR-2C. |
Transient overexpression lysate of 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
HTR2C rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 2C (HTR2C), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
HTR2C rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HTR2C HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Polyclonal Antibody against HTR2C
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QVENLELPVN, from the internal region of the protein sequence according to NP_000859.1. |
Rabbit Polyclonal Anti-HTR2C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA |
HTR2C (untagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
HTR2C (untagged) - Homo sapiens 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled (HTR2C), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Rabbit Polyclonal Anti-HTR2C Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HTR2C |
Transient overexpression of HTR2C (NM_000868) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HTR2C (NM_001256761) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HTR2C (NM_001256760) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HTR2C (NM_000868) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HTR2C (NM_000868) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HTR2C (NM_001256761) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HTR2C (NM_001256760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HTR2C (NM_001256760) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- HTR2C
Pathways
- Gap junction