Germany
Japan
United Kingdom
China
TUBB2B (Myc-DDK-tagged)-Human tubulin, beta 2B (TUBB2B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human tubulin, beta 2B (TUBB2B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, TUBB2B (Myc-DDK tagged) - Human tubulin, beta 2B (TUBB2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, TUBB2B (mGFP-tagged) - Human tubulin, beta 2B (TUBB2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TUBB2B (GFP-tagged) - Human tubulin, beta 2B (TUBB2B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TUBB2B (Myc-DDK tagged) - Human tubulin, beta 2B (TUBB2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TUBB2B (mGFP-tagged) - Human tubulin, beta 2B (TUBB2B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-TUBB2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2B antibody is: synthetic peptide directed towards the N-terminal region of Human TUBB2B. Synthetic peptide located within the following region: GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSV |
Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TUBB2B (untagged)-Human tubulin, beta 2B (TUBB2B)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal TUBB2B Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TUBB2B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-39 amino acids from the N-terminal region of human TUBB2B. |
TUBB2B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tubulin, beta 2B (TUBB2B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TUBB2B MS Standard C13 and N15-labeled recombinant protein (NP_821080)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 420.00
4 Weeks
Transient overexpression of TUBB2B (NM_178012) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TUBB2B (NM_178012) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TUBB2B (NM_178012) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TUBB2B
Pathways
- Gap junction