TUBB2B (Myc-DDK-tagged)-Human tubulin, beta 2B (TUBB2B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TUBB2B (Myc-DDK-tagged)-Human tubulin, beta 2B (TUBB2B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human tubulin, beta 2B (TUBB2B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF particles, TUBB2B (Myc-DDK tagged) - Human tubulin, beta 2B (TUBB2B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, TUBB2B (mGFP-tagged) - Human tubulin, beta 2B (TUBB2B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Tubb2b (Myc-DDK-tagged) - Mouse tubulin, beta 2B (Tubb2b)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Tubb2b (GFP-tagged) - Mouse tubulin beta 2B (Tubb2b), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TUBB2B (GFP-tagged) - Human tubulin, beta 2B (TUBB2B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TUBB2B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Tubb2b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Tubb2b (Myc-DDK-tagged) - Mouse tubulin, beta 2B (Tubb2b)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Tubb2b (Myc-DDK-tagged) - Mouse tubulin, beta 2B (Tubb2b), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Tubb2b (mGFP-tagged) - Mouse tubulin, beta 2B (Tubb2b)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Tubb2b (GFP-tagged) - Mouse tubulin, beta 2B (Tubb2b), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TUBB2B (Myc-DDK tagged) - Human tubulin, beta 2B (TUBB2B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TUBB2B (mGFP-tagged) - Human tubulin, beta 2B (TUBB2B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Tubb2b (Myc-DDK-tagged ORF) - Rat tubulin, beta 2b (Tubb2b), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Tubb2b (Myc-DDK-tagged ORF) - Rat tubulin, beta 2b (Tubb2b), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Tubb2b (Myc-DDK-tagged ORF) - Rat tubulin, beta 2b (Tubb2b), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Tubb2b (mGFP-tagged ORF) - Rat tubulin, beta 2b (Tubb2b), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Tubb2b (GFP-tagged ORF) - Rat tubulin, beta 2b (Tubb2b), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TUBB2B mouse monoclonal antibody, clone AT5B3, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-TUBB2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUBB2B antibody is: synthetic peptide directed towards the N-terminal region of Human TUBB2B. Synthetic peptide located within the following region: GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSV |
TUBB2B mouse monoclonal antibody, clone AT5B3, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
TUBB2B mouse monoclonal antibody, clone AT5B2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
TUBB2B mouse monoclonal antibody, clone AT5B2, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
TUBB2B (untagged)-Human tubulin, beta 2B (TUBB2B)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal TUBB2B Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TUBB2B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-39 amino acids from the N-terminal region of human TUBB2B. |
TUBB2B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TUBB2B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression lysate of tubulin, beta 2B (TUBB2B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody,clone OTI6D11
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody,clone OTI5D3
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody,clone OTI2H4
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody,clone OTI2G4
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody, clone OTI0C3 (formerly 0C3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody, clone OTI8F12 (formerly 8F12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TUBB2B CRISPRa kit - CRISPR gene activation of human tubulin beta 2B class IIb
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene TUBB2B
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene TUBB2B
Tubb2b (untagged) - Mouse tubulin, beta 2B (Tubb2b), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Tubb2b
TUBB2B MS Standard C13 and N15-labeled recombinant protein (NP_821080)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Tubb2b (untagged ORF) - Rat tubulin, beta 2b (Tubb2b), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of tubulin beta 2B (TUBB2B) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |