Products

View as table Download

TUBB2B (Myc-DDK-tagged)-Human tubulin, beta 2B (TUBB2B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human tubulin, beta 2B (TUBB2B)

Tag C-Myc/DDK
Expression Host HEK293T

Tubb2b (Myc-DDK-tagged) - Mouse tubulin, beta 2B (Tubb2b)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Tubb2b (GFP-tagged) - Mouse tubulin beta 2B (Tubb2b), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TUBB2B (GFP-tagged) - Human tubulin, beta 2B (TUBB2B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TUBB2B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN409075 is the updated version of KN209075.

Tubb2b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN518468 is the updated version of KN318468.

Lenti ORF clone of Tubb2b (Myc-DDK-tagged) - Mouse tubulin, beta 2B (Tubb2b)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Tubb2b (mGFP-tagged) - Mouse tubulin, beta 2B (Tubb2b)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Tubb2b (Myc-DDK-tagged ORF) - Rat tubulin, beta 2b (Tubb2b), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Tubb2b (Myc-DDK-tagged ORF) - Rat tubulin, beta 2b (Tubb2b), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Tubb2b (mGFP-tagged ORF) - Rat tubulin, beta 2b (Tubb2b), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

TUBB2B mouse monoclonal antibody, clone AT5B3, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse

Rabbit Polyclonal Anti-TUBB2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB2B antibody is: synthetic peptide directed towards the N-terminal region of Human TUBB2B. Synthetic peptide located within the following region: GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSV

TUBB2B mouse monoclonal antibody, clone AT5B3, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse

TUBB2B mouse monoclonal antibody, clone AT5B2, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse

TUBB2B mouse monoclonal antibody, clone AT5B2, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse

Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human tubulin, beta 2B (TUBB2B), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

TUBB2B (untagged)-Human tubulin, beta 2B (TUBB2B)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit polyclonal TUBB2B Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TUBB2B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-39 amino acids from the N-terminal region of human TUBB2B.

TUBB2B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

TUBB2B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody,clone OTI6D11

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody,clone OTI5D3

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody,clone OTI2H4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody,clone OTI2G4

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody, clone OTI0C3 (formerly 0C3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody, clone OTI8F12 (formerly 8F12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TUBB2B mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TUBB2B CRISPRa kit - CRISPR gene activation of human tubulin beta 2B class IIb

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene TUBB2B

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene TUBB2B

Tubb2b (untagged) - Mouse tubulin, beta 2B (Tubb2b), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Tubb2b

TUBB2B MS Standard C13 and N15-labeled recombinant protein (NP_821080)

Tag C-Myc/DDK
Expression Host HEK293

Tubb2b (untagged ORF) - Rat tubulin, beta 2b (Tubb2b), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of tubulin beta 2B (TUBB2B) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase