AWAT2 (Myc-DDK-tagged)-Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AWAT2 (Myc-DDK-tagged)-Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, AWAT2 (Myc-DDK tagged) - Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, AWAT2 (mGFP-tagged) - Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
AWAT2 (GFP-tagged) - Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, AWAT2 (Myc-DDK tagged) - Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, AWAT2 (mGFP-tagged) - Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
AWAT2 (untagged)-Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
DGAT2L4 (AWAT2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 306-335 amino acids from the C-terminal region of human AWAT2 |
Rabbit Polyclonal Anti-DGAT2L4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGAT2L4 antibody: synthetic peptide directed towards the C terminal of human DGAT2L4. Synthetic peptide located within the following region: GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII |
AWAT2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of acyl-CoA wax alcohol acyltransferase 2 (AWAT2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of AWAT2 (NM_001002254) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AWAT2 (NM_001002254) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AWAT2 (NM_001002254) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack