Products

cDNA Clones (10)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
DGAT2L4 (AWAT2) (NM_001002254) Human Tagged ORF Clone
RC220971

USD 420.00

In Stock

AWAT2 (Myc-DDK-tagged)-Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DGAT2L4 (AWAT2) (NM_001002254) Human Tagged ORF Clone
RG220971

USD 460.00

In Stock

AWAT2 (GFP-tagged) - Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DGAT2L4 (AWAT2) (NM_001002254) Human Tagged ORF Clone
RC220971L3

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DGAT2L4 (AWAT2) (NM_001002254) Human Tagged ORF Clone Lentiviral Particle
RC220971L3V

USD 820.00

5 Weeks

Lenti ORF particles, AWAT2 (Myc-DDK tagged) - Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DGAT2L4 (AWAT2) (NM_001002254) Human Tagged ORF Clone
RC220971L4

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DGAT2L4 (AWAT2) (NM_001002254) Human Untagged Clone
SC300419

USD 570.00

In Stock

AWAT2 (untagged)-Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
DGAT2L4 (AWAT2) (NM_001002254) Human Tagged ORF Clone
RC220971L2

USD 620.00

3 Weeks

Lenti ORF clone of Human acyl-CoA wax alcohol acyltransferase 2 (AWAT2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DGAT2L4 (AWAT2) (C-term) Rabbit Polyclonal Antibody
AP50318PU-N

USD 450.00

2 Weeks

DGAT2L4 (AWAT2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 306-335 amino acids from the C-terminal region of human AWAT2
DGAT2L4 (AWAT2) Rabbit Polyclonal Antibody
TA335288

USD 375.00

5 Days

Rabbit Polyclonal Anti-DGAT2L4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGAT2L4 antibody: synthetic peptide directed towards the C terminal of human DGAT2L4. Synthetic peptide located within the following region: GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII
DGAT2L4 (AWAT2) (NM_001002254) Human Over-expression Lysate
LC424189

USD 121.00

2 Weeks

AWAT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DGAT2L4 (AWAT2) (NM_001002254) Human Over-expression Lysate
LY424189

USD 396.00

5 Days

Transient overexpression lysate of acyl-CoA wax alcohol acyltransferase 2 (AWAT2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DGAT2L4 (AWAT2) (NM_001002254) ICC Control Block
TB420971

USD 1,070.00

4 Weeks

Transient overexpression of AWAT2 (NM_001002254) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DGAT2L4 (AWAT2) Cytosection
TS420971

USD 225.00

4 Weeks

Transient overexpression of AWAT2 (NM_001002254) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DGAT2L4 (AWAT2) Cytosection
TS420971P5

USD 889.00

4 Weeks

Transient overexpression of AWAT2 (NM_001002254) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack