Products

Proteins (7)
cDNA Clones (7)
Antibodies (1)
Jump to Filters
View as table Download
MIR16 (GDE1) (NM_016641) Human Tagged ORF Clone
RC204923

USD 420.00

In Stock

GDE1 (Myc-DDK-tagged)-Human glycerophosphodiester phosphodiesterase 1 (GDE1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MIR16 (GDE1) (NM_016641) Human Tagged ORF Clone
RG204923

USD 460.00

In Stock

GDE1 (GFP-tagged) - Human glycerophosphodiester phosphodiesterase 1 (GDE1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MIR16 (GDE1) (NM_016641) Human Tagged ORF Clone
RC204923L3

USD 620.00

3 Weeks

Lenti ORF clone of Human glycerophosphodiester phosphodiesterase 1 (GDE1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MIR16 (GDE1) (NM_016641) Human Tagged ORF Clone
RC204923L4

USD 620.00

3 Weeks

Lenti ORF clone of Human glycerophosphodiester phosphodiesterase 1 (GDE1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MIR16 (GDE1) (NM_016641) Human Untagged Clone
SC108185

USD 310.00

In Stock

GDE1 (untagged)-Human glycerophosphodiester phosphodiesterase 1 (GDE1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
MIR16 (GDE1) Rabbit Polyclonal Antibody
TA342023

USD 375.00

5 Days

Rabbit Polyclonal Anti-GDE1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GDE1 antibody: synthetic peptide directed towards the N terminal of human GDE1. Synthetic peptide located within the following region: LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN
MIR16 (GDE1) (NM_016641) Human Over-expression Lysate
LC402574

USD 121.00

2 Weeks

GDE1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MIR16 (GDE1) (NM_016641) Human Over-expression Lysate
LY402574

USD 396.00

5 Days

Transient overexpression lysate of glycerophosphodiester phosphodiesterase 1 (GDE1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MIR16 (GDE1) (NM_016641) Human Mass Spec Standard
PH304923

USD 2,055.00

3 Weeks

GDE1 MS Standard C13 and N15-labeled recombinant protein (NP_057725)

Tag C-Myc/DDK
Expression Host HEK293
MIR16 (GDE1) (NM_016641) ICC Control Block
TB404923

USD 1,070.00

4 Weeks

Transient overexpression of GDE1 (NM_016641) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MIR16 (GDE1) Cytosection
TS404923

USD 225.00

4 Weeks

Transient overexpression of GDE1 (NM_016641) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MIR16 (GDE1) Cytosection
TS404923P5

USD 889.00

4 Weeks

Transient overexpression of GDE1 (NM_016641) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack