Products

cDNA Clones (25)
Proteins (20)
Antibodies (2)
Jump to Filters
View as table Download
Lysophospholipase 1 (LYPLA1) (NM_001279360) Human Tagged ORF Clone
RC236208

USD 420.00

2 Weeks

LYPLA1 (myc-DDK-tagged) - Human lysophospholipase I (LYPLA1), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lysophospholipase 1 (LYPLA1) (NM_001279359) Human Tagged ORF Clone
RC236333

USD 420.00

2 Weeks

LYPLA1 (myc-DDK-tagged) - Human lysophospholipase I (LYPLA1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lysophospholipase 1 (LYPLA1) (NM_001279356) Human Tagged ORF Clone
RC236480

USD 420.00

2 Weeks

LYPLA1 (myc-DDK-tagged) - Human lysophospholipase I (LYPLA1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lysophospholipase 1 (LYPLA1) (NM_001279357) Human Tagged ORF Clone
RC236623

USD 420.00

2 Weeks

LYPLA1 (myc-DDK-tagged) - Human lysophospholipase I (LYPLA1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lysophospholipase 1 (LYPLA1) (NM_001279358) Human Tagged ORF Clone
RC236641

USD 420.00

2 Weeks

LYPLA1 (myc-DDK-tagged) - Human lysophospholipase I (LYPLA1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Lysophospholipase 1 (LYPLA1) (NM_006330) Human Recombinant Protein
TP760001

USD 215.00

In Stock

Recombinant protein of human lysophospholipase I (LYPLA1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
Lysophospholipase 1 (LYPLA1) (NM_006330) Human Untagged Clone
SC324134

USD 310.00

In Stock

LYPLA1 (untagged)-Human lysophospholipase I (LYPLA1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Lysophospholipase 1 (LYPLA1) Rabbit Polyclonal Antibody
TA312315

USD 345.00

4 Weeks

Rabbit polyclonal anti-LYPLA1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LYPLA1.
Lysophospholipase 1 (LYPLA1) (NM_006330) Human Over-expression Lysate
LC401905

USD 121.00

In Stock

LYPLA1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Lysophospholipase 1 (LYPLA1) (NM_006330) Human Over-expression Lysate
LY401905

USD 396.00

5 Days

Transient overexpression lysate of lysophospholipase I (LYPLA1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Lysophospholipase 1 (LYPLA1) Rabbit Polyclonal Antibody
TA340098

USD 375.00

5 Days

Rabbit Polyclonal Anti-LYPLA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYPLA1 antibody: synthetic peptide directed towards the middle region of human LYPLA1. Synthetic peptide located within the following region: SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
Lysophospholipase 1 (LYPLA1) (NM_001279360) Human Tagged ORF Clone
RG236208

USD 460.00

2 Weeks

LYPLA1 (GFP-tagged) - Human lysophospholipase I (LYPLA1), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lysophospholipase 1 (LYPLA1) (NM_001279359) Human Tagged ORF Clone
RG236333

USD 460.00

2 Weeks

LYPLA1 (GFP-tagged) - Human lysophospholipase I (LYPLA1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lysophospholipase 1 (LYPLA1) (NM_001279356) Human Tagged ORF Clone
RG236480

USD 460.00

2 Weeks

LYPLA1 (GFP-tagged) - Human lysophospholipase I (LYPLA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lysophospholipase 1 (LYPLA1) (NM_001279357) Human Tagged ORF Clone
RG236623

USD 460.00

2 Weeks

LYPLA1 (GFP-tagged) - Human lysophospholipase I (LYPLA1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lysophospholipase 1 (LYPLA1) (NM_001279358) Human Tagged ORF Clone
RG236641

USD 460.00

2 Weeks

LYPLA1 (GFP-tagged) - Human lysophospholipase I (LYPLA1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lysophospholipase 1 (LYPLA1) (NM_001279360) Human Untagged Clone
SC334102

USD 310.00

2 Weeks

LYPLA1 (untagged) - Human lysophospholipase I (LYPLA1), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lysophospholipase 1 (LYPLA1) (NM_001279359) Human Untagged Clone
SC334227

USD 477.00

2 Weeks

LYPLA1 (untagged) - Human lysophospholipase I (LYPLA1), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lysophospholipase 1 (LYPLA1) (NM_001279356) Human Untagged Clone
SC334374

USD 477.00

2 Weeks

LYPLA1 (untagged) - Human lysophospholipase I (LYPLA1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lysophospholipase 1 (LYPLA1) (NM_001279357) Human Untagged Clone
SC334517

USD 477.00

2 Weeks

LYPLA1 (untagged) - Human lysophospholipase I (LYPLA1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lysophospholipase 1 (LYPLA1) (NM_001279358) Human Untagged Clone
SC334535

USD 477.00

2 Weeks

LYPLA1 (untagged) - Human lysophospholipase I (LYPLA1), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lysophospholipase 1 (LYPLA1) (NM_006330) ICC Control Block
TB402029

USD 1,040.00

4 Weeks

Transient overexpression of LYPLA1 (NM_006330) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Lysophospholipase 1 (LYPLA1) (NM_001279360) ICC Control Block
TB436208

USD 1,070.00

4 Weeks

Transient overexpression of LYPLA1 (NM_001279360) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Lysophospholipase 1 (LYPLA1) (NM_001279359) ICC Control Block
TB436333

USD 1,070.00

4 Weeks

Transient overexpression of LYPLA1 (NM_001279359) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Lysophospholipase 1 (LYPLA1) (NM_001279356) ICC Control Block
TB436480

USD 1,070.00

4 Weeks

Transient overexpression of LYPLA1 (NM_001279356) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Lysophospholipase 1 (LYPLA1) (NM_001279357) ICC Control Block
TB436623

USD 1,070.00

4 Weeks

Transient overexpression of LYPLA1 (NM_001279357) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Lysophospholipase 1 (LYPLA1) (NM_001279358) ICC Control Block
TB436641

USD 1,070.00

4 Weeks

Transient overexpression of LYPLA1 (NM_001279358) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Lysophospholipase 1 (LYPLA1) (NM_006330) Human Recombinant Protein
TP720607

USD 330.00

3 Weeks

Purified recombinant protein of Human lysophospholipase I (LYPLA1)

Tag N-His
Expression Host E. coli
Lysophospholipase 1 (LYPLA1) (NM_006330) Human Recombinant Protein
TP720607L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human lysophospholipase I (LYPLA1)

Tag N-His
Expression Host E. coli
Lysophospholipase 1 (LYPLA1) (NM_006330) Human Recombinant Protein
TP720607M

USD 760.00

3 Weeks

Purified recombinant protein of Human lysophospholipase I (LYPLA1)

Tag N-His
Expression Host E. coli
Lysophospholipase 1 (LYPLA1) (NM_006330) Human Recombinant Protein
TP720607XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human lysophospholipase I (LYPLA1)

Tag N-His
Expression Host E. coli
Lysophospholipase 1 (LYPLA1) Cytosection
TS402029

USD 225.00

4 Weeks

Transient overexpression of LYPLA1 (NM_006330) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Lysophospholipase 1 (LYPLA1) Cytosection
TS402029P5

USD 889.00

4 Weeks

Transient overexpression of LYPLA1 (NM_006330) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Lysophospholipase 1 (LYPLA1) ICC Control Sections
TS436208P5

USD 889.00

4 Weeks

Transient overexpression of LYPLA1 (NM_001279360) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Lysophospholipase 1 (LYPLA1) ICC Control Sections
TS436333P5

USD 889.00

4 Weeks

Transient overexpression of LYPLA1 (NM_001279359) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Lysophospholipase 1 (LYPLA1) ICC Control Sections
TS436480P5

USD 889.00

4 Weeks

Transient overexpression of LYPLA1 (NM_001279356) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Lysophospholipase 1 (LYPLA1) ICC Control Sections
TS436623P5

USD 889.00

4 Weeks

Transient overexpression of LYPLA1 (NM_001279357) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Lysophospholipase 1 (LYPLA1) ICC Control Sections
TS436641P5

USD 889.00

4 Weeks

Transient overexpression of LYPLA1 (NM_001279358) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack