Products

cDNA Clones (7)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
DMGDH (NM_013391) Human Tagged ORF Clone
RC223089

USD 750.00

In Stock

DMGDH (Myc-DDK-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DMGDH (NM_013391) Human Tagged ORF Clone
RC223089L3

USD 950.00

3 Weeks

Lenti-ORF clone of DMGDH (Myc-DDK-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DMGDH (NM_013391) Human Tagged ORF Clone Lentiviral Particle
RC223089L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, DMGDH (Myc-DDK-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DMGDH (NM_013391) Human Tagged ORF Clone
RC223089L4

USD 950.00

3 Weeks

Lenti-ORF clone of DMGDH (mGFP-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DMGDH (NM_013391) Human Tagged ORF Clone Lentiviral Particle
RC223089L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, DMGDH (mGFP-tagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DMGDH (NM_013391) Human Tagged ORF Clone
RG223089

USD 830.00

3 Weeks

DMGDH (GFP-tagged) - Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DMGDH Rabbit Polyclonal Antibody
TA315405

USD 345.00

In Stock

Rabbit polyclonal anti-DMGDH antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human DMGDH.
DMGDH (NM_013391) Human Untagged Clone
SC124128

USD 1,760.00

In Stock

DMGDH (untagged)-Human dimethylglycine dehydrogenase (DMGDH), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC124128 is the updated version of SC115245.
DMGDH Rabbit Polyclonal Antibody
TA338400

USD 375.00

5 Days

Rabbit Polyclonal Anti-Dmgdh Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dmgdh antibody is: synthetic peptide directed towards the middle region of Mouse Dmgdh. Synthetic peptide located within the following region: SELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSE
DMGDH Rabbit Polyclonal Antibody
TA358745

USD 360.00

5 Days

DMGDH Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
DMGDH (NM_013391) ICC Control Block
TB423089

USD 1,400.00

4 Weeks

Transient overexpression of DMGDH (NM_013391) in HEK293T cells paraffin embedded controls for ICC/IHC staining

DMGDH Cytosection
TS423089

USD 225.00

4 Weeks

Transient overexpression of DMGDH (NM_013391) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

DMGDH Cytosection
TS423089P5

USD 889.00

4 Weeks

Transient overexpression of DMGDH (NM_013391) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack