Products

Proteins (20)
cDNA Clones (19)
Antibodies (2)
Jump to Filters
View as table Download
GAMT (NM_000156) Human Tagged ORF Clone Lentiviral Particle
RC200528L1V

USD 820.00

3 Weeks

Lenti ORF particles, GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GAMT (NM_000156) Human Tagged ORF Clone Lentiviral Particle
RC200528L2V

USD 820.00

6 Weeks

Lenti ORF particles, GAMT (mGFP-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GAMT (NM_000156) Human Tagged ORF Clone
RC200528

USD 420.00

2 Weeks

GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GAMT (NM_000156) Human Tagged ORF Clone
RG200528

USD 460.00

In Stock

GAMT (GFP-tagged) - Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GAMT (NM_000156) Human Tagged ORF Clone
RC200528L3

USD 620.00

3 Weeks

Lenti-ORF clone of GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GAMT (NM_000156) Human Tagged ORF Clone Lentiviral Particle
RC200528L3V

USD 820.00

5 Weeks

Lenti ORF particles, GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GAMT (NM_000156) Human Tagged ORF Clone
RC200528L4

USD 620.00

3 Weeks

Lenti-ORF clone of GAMT (mGFP-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GAMT (NM_000156) Human Tagged ORF Clone Lentiviral Particle
RC200528L4V

USD 820.00

11 Weeks

Lenti ORF particles, GAMT (mGFP-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GAMT (NM_138924) Human Tagged ORF Clone
RC216741

USD 420.00

3 Weeks

GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GAMT (NM_138924) Human Tagged ORF Clone
RC216741L3

USD 620.00

3 Weeks

Lenti ORF clone of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GAMT (NM_138924) Human Tagged ORF Clone Lentiviral Particle
RC216741L3V

USD 820.00

6 Weeks

Lenti ORF particles, GAMT (Myc-DDK tagged) - Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GAMT (NM_138924) Human Tagged ORF Clone
RC216741L4

USD 620.00

3 Weeks

Lenti ORF clone of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GAMT (NM_138924) Human Tagged ORF Clone Lentiviral Particle
RC216741L4V

USD 820.00

6 Weeks

Lenti ORF particles, GAMT (mGFP-tagged) - Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GAMT (NM_138924) Human Tagged ORF Clone
RG216741

USD 460.00

3 Weeks

GAMT (GFP-tagged) - Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GAMT (NM_000156) Human Tagged ORF Clone
RC200528L1

USD 768.00

In Stock

Lenti-ORF clone of GAMT (Myc-DDK-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GAMT Rabbit Polyclonal Antibody
TA346164

USD 475.00

5 Days

Rabbit Polyclonal Anti-GAMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAMT antibody: synthetic peptide directed towards the N terminal of human GAMT. Synthetic peptide located within the following region: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM
GAMT (NM_000156) Human Tagged ORF Clone
RC200528L2

USD 620.00

3 Weeks

Lenti-ORF clone of GAMT (mGFP-tagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GAMT (NM_000156) Human Untagged Clone
SC320844

USD 310.00

In Stock

GAMT (untagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GAMT (NM_000156) Human Over-expression Lysate
LC424896

USD 121.00

In Stock

GAMT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAMT (NM_000156) Human Untagged Clone
SC120079

USD 310.00

In Stock

GAMT (untagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GAMT Rabbit Polyclonal Antibody
TA329508

USD 375.00

5 Days

Rabbit Polyclonal anti-GAMT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAMT antibody: synthetic peptide directed towards the middle region of human GAMT. Synthetic peptide located within the following region: PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI
GAMT (1-236, His-tag) Human Protein
AR09307PU-L

USD 745.00

2 Weeks

GAMT (1-236, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
GAMT (1-236, His-tag) Human Protein
AR09307PU-N

USD 300.00

2 Weeks

GAMT (1-236, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
GAMT (NM_138924) Human Over-expression Lysate
LC408469

USD 121.00

2 Weeks

GAMT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAMT (NM_138924) Human Over-expression Lysate
LC430068

USD 121.00

2 Weeks

GAMT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAMT (NM_138924) Human Over-expression Lysate
LY408469

USD 396.00

5 Days

Transient overexpression lysate of guanidinoacetate N-methyltransferase (GAMT), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY408469 is the same product as LY430068.
GAMT (NM_000156) Human Over-expression Lysate
LY424896

USD 396.00

5 Days

Transient overexpression lysate of guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAMT (NM_138924) Human Over-expression Lysate
LY430068

USD 396.00

5 Days

Transient overexpression lysate of guanidinoacetate N-methyltransferase (GAMT), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GAMT (NM_000156) Human Mass Spec Standard
PH300528

USD 2,055.00

3 Weeks

GAMT MS Standard C13 and N15-labeled recombinant protein (NP_000147)

Tag C-Myc/DDK
Expression Host HEK293
GAMT (NM_138924) Human Mass Spec Standard
PH316741

USD 2,055.00

3 Weeks

GAMT MS Standard C13 and N15-labeled recombinant protein (NP_620279)

Tag C-Myc/DDK
Expression Host HEK293
GAMT (NM_138924) Human Untagged Clone
SC120642

USD 660.00

4 Weeks

GAMT (untagged)-Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GAMT ICC Control Block
TB400528

USD 1,070.00

4 Weeks

Transient overexpression of GAMT (NM_000156) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GAMT ICC Control Block
TB416741

USD 1,070.00

4 Weeks

Transient overexpression of GAMT (NM_138924) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GAMT (NM_000156) Human Recombinant Protein
TP721002

USD 330.00

3 Weeks

Purified recombinant protein of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Tag N-His&C-His
Expression Host E. coli
GAMT (NM_000156) Human Recombinant Protein
TP721002L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Tag N-His&C-His
Expression Host E. coli
GAMT (NM_000156) Human Recombinant Protein
TP721002M

USD 760.00

3 Weeks

Purified recombinant protein of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Tag N-His&C-His
Expression Host E. coli
GAMT (NM_000156) Human Recombinant Protein
TP721002XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1

Tag N-His&C-His
Expression Host E. coli
GAMT ICC Control Sections
TS400528P5

USD 889.00

4 Weeks

Transient overexpression of GAMT (NM_000156) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GAMT Cytosection
TS416741

USD 225.00

10 Weeks

Transient overexpression of GAMT (NM_138924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GAMT Cytosection
TS416741P5

USD 889.00

4 Weeks

Transient overexpression of GAMT (NM_138924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack