ADH6 (Myc-DDK-tagged)-Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADH6 (Myc-DDK-tagged)-Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ADH6 (Myc-DDK tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ADH6 (mGFP-tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ADH6 (Myc-DDK-tagged)-Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADH6 (GFP-tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADH6 (Myc-DDK tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADH6 (mGFP-tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADH6 (Myc-DDK tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADH6 (mGFP-tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADH6 (GFP-tagged) - Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ADH6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADH6 antibody: synthetic peptide directed towards the middle region of human ADH6. Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID |
ADH6 (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 217~247 amino acids from the Center region of human ADH6 |
Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ADH6 (untagged)-Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ADH6 (untagged)-Human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Alcohol dehydrogenase 6 / ADH6 (1-375, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Alcohol dehydrogenase 6 / ADH6 (1-375, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
ADH6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ADH6 MS Standard C13 and N15-labeled recombinant protein (NP_001095940)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of ADH6 (NM_000672) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADH6 (NM_001102470) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADH6 (NM_000672) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ADH6 (NM_000672) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ADH6 (NM_001102470) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ADH6 (NM_001102470) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack